5-hydroxytryptamine receptor 2A

Details

Name
5-hydroxytryptamine receptor 2A
Synonyms
  • 5-HT-2
  • HTR2
  • Serotonin receptor 2A
Gene Name
HTR2A
Organism
Human
Amino acid sequence
>lcl|BSEQ0000899|5-hydroxytryptamine receptor 2A
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Number of residues
471
Molecular Weight
52602.58
Theoretical pI
7.72
GO Classification
Functions
drug binding / 1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding / virus receptor activity / serotonin binding / serotonin receptor activity
Processes
regulation of hormone secretion / serotonin receptor signaling pathway / memory / response to drug / detection of mechanical stimulus involved in sensory perception of pain / urinary bladder smooth muscle contraction / aging / cell death / phosphatidylinositol 3-kinase signaling / positive regulation of fat cell differentiation / protein localization to cytoskeleton / detection of temperature stimulus involved in sensory perception of pain / artery smooth muscle contraction / cellular calcium ion homeostasis / negative regulation of synaptic transmission, glutamatergic / synaptic transmission / temperature homeostasis / phospholipase C-activating serotonin receptor signaling pathway / activation of phospholipase C activity / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of phosphatidylinositol biosynthetic process / positive regulation of vasoconstriction / positive regulation of glycolytic process / release of sequestered calcium ion into cytosol / positive regulation of MAP kinase activity / behavioral response to cocaine / positive regulation of cell proliferation / regulation of behavior / negative regulation of potassium ion transport / sleep / positive regulation of ERK1 and ERK2 cascade / regulation of dopamine secretion
Components
neuronal cell body / dendritic shaft / caveola / plasma membrane / cytoplasmic membrane-bounded vesicle / cytosol / axon / integral component of plasma membrane / cell body fiber
General Function
Virus receptor activity
Specific Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.(Microbial infection) Acts as a receptor for human JC polyomavirus/JCPyV.
Pfam Domain Function
Transmembrane Regions
76-99 111-132 149-171 192-215 234-254 325-346 363-384
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0020465|5-hydroxytryptamine receptor 2A (HTR2A)
ATGGATATTCTTTGTGAAGAAAATACTTCTTTGAGCTCAACTACGAACTCCCTAATGCAA
TTAAATGATGACACCAGGCTCTACAGTAATGACTTTAACTCCGGAGAAGCTAACACTTCT
GATGCATTTAACTGGACAGTCGACTCTGAAAATCGAACCAACCTTTCCTGTGAAGGGTGC
CTCTCACCGTCGTGTCTCTCCTTACTTCATCTCCAGGAAAAAAACTGGTCTGCTTTACTG
ACAGCCGTAGTGATTATTCTAACTATTGCTGGAAACATACTCGTCATCATGGCAGTGTCC
CTAGAGAAAAAGCTGCAGAATGCCACCAACTATTTCCTGATGTCACTTGCCATAGCTGAT
ATGCTGCTGGGTTTCCTTGTCATGCCCGTGTCCATGTTAACCATCCTGTATGGGTACCGG
TGGCCTCTGCCGAGCAAGCTTTGTGCAGTCTGGATTTACCTGGACGTGCTCTTCTCCACG
GCCTCCATCATGCACCTCTGCGCCATCTCGCTGGACCGCTACGTCGCCATCCAGAATCCC
ATCCACCACAGCCGCTTCAACTCCAGAACTAAGGCATTTCTGAAAATCATTGCTGTTTGG
ACCATATCAGTAGGTATATCCATGCCAATACCAGTCTTTGGGCTACAGGACGATTCGAAG
GTCTTTAAGGAGGGGAGTTGCTTACTCGCCGATGATAACTTTGTCCTGATCGGCTCTTTT
GTGTCATTTTTCATTCCCTTAACCATCATGGTGATCACCTACTTTCTAACTATCAAGTCA
CTCCAGAAAGAAGCTACTTTGTGTGTAAGTGATCTTGGCACACGGGCCAAATTAGCTTCT
TTCAGCTTCCTCCCTCAGAGTTCTTTGTCTTCAGAAAAGCTCTTCCAGCGGTCGATCCAT
AGGGAGCCAGGGTCCTACACAGGCAGGAGGACTATGCAGTCCATCAGCAATGAGCAAAAG
GCATGCAAGGTGCTGGGCATCGTCTTCTTCCTGTTTGTGGTGATGTGGTGCCCTTTCTTC
ATCACAAACATCATGGCCGTCATCTGCAAAGAGTCCTGCAATGAGGATGTCATTGGGGCC
CTGCTCAATGTGTTTGTTTGGATCGGTTATCTCTCTTCAGCAGTCAACCCACTAGTCTAC
ACACTGTTCAACAAGACCTATAGGTCAGCCTTTTCACGGTATATTCAGTGTCAGTACAAG
GAAAACAAAAAACCATTGCAGTTAATTTTAGTGAACACAATACCGGCTTTGGCCTACAAG
TCTAGCCAACTTCAAATGGGACAAAAAAAGAATTCAAAGCAAGATGCCAAGACAACAGAT
AATGACTGCTCAATGGTTGCTCTAGGAAAGCAGCATTCTGAAGAGGCTTCTAAAGACAAT
AGCGACGGAGTGAATGAAAAGGTGAGCTGTGTGTGA
Chromosome Location
13
Locus
13q14-q21
External Identifiers
ResourceLink
UniProtKB IDP28223
UniProtKB Entry Name5HT2A_HUMAN
GenBank Protein ID36431
GenBank Gene IDS42168
GenAtlas IDHTR2A
HGNC IDHGNC:5293
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00247MethysergideapprovedyesantagonistDetails
DB00370MirtazapineapprovedyesantagonistDetails
DB00434CyproheptadineapprovedyesantagonistDetails
DB00656Trazodoneapproved, investigationalyesantagonistDetails
DB00924CyclobenzaprineapprovedyesantagonistDetails
DB01149Nefazodoneapproved, withdrawnyesantagonistDetails
DB01224QuetiapineapprovedyesantagonistDetails
DB00246ZiprasidoneapprovedyesantagonistDetails
DB00334Olanzapineapproved, investigationalyesantagonistDetails
DB00363ClozapineapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00477Chlorpromazineapproved, vet_approvedyesantagonistDetails
DB00679Thioridazineapproved, withdrawnyesantagonistDetails
DB00734Risperidoneapproved, investigationalyesantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00805MinaprineapprovedyesantagonistDetails
DB00933Mesoridazineapproved, investigationalyesantagonistDetails
DB01069PromethazineapprovedunknownantagonistDetails
DB01238Aripiprazoleapproved, investigationalyesantagonistDetails
DB01267PaliperidoneapprovedyesantagonistDetails
DB00696ErgotamineapprovedyesagonistDetails
DB00715Paroxetineapproved, investigationalunknownother/unknownDetails
DB00843Donepezilapprovedunknownother/unknownDetails
DB01242Clomipramineapproved, vet_approvedyesantagonistDetails
DB01442MMDAexperimental, illicityesagonistDetails
DB01239Chlorprothixeneapproved, investigational, withdrawnyesantagonistDetails
DB00751Epinastineapproved, investigationalunknownantagonistDetails
DB05227APD791investigationalunknownDetails
DB06144Sertindoleapproved, investigational, withdrawnyesantagonistDetails
DB04908FlibanserinapprovedyesantagonistDetails
DB12555NelotanserininvestigationalunknownDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB05079HY10275investigationalunknownDetails
DB05316Pimavanserinapproved, investigationalyesinverse agonistDetails
DB04946IloperidoneapprovedyesantagonistDetails
DB05687BL-1020investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB00604Cisaprideapproved, investigational, withdrawnyesagonistDetails
DB06077LumateperoneinvestigationalunknownDetails
DB06216AsenapineapprovedyesantagonistDetails
DB06512DeramciclaneinvestigationalunknownantagonistDetails
DB04599AniracetamexperimentalunknownDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalyesagonistDetails
DB00248CabergolineapprovedunknownagonistDetails
DB00413Pramipexoleapproved, investigationalunknownunknownDetails
DB00268Ropiniroleapproved, investigationalunknownagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00875Flupentixolapproved, withdrawnyesantagonistDetails
DB00502Haloperidolapprovedunknownother/unknownDetails
DB01403MethotrimeprazineapprovedunknownantagonistDetails
DB01618MolindoneapprovedunknownantagonistDetails
DB01488Dimethyltryptamineexperimental, illicitunknownDetails
DB01624Zuclopenthixolapproved, investigationalunknownantagonistDetails
DB00408LoxapineapprovedyesantagonistDetails
DB00321AmitriptylineapprovedyesantagonistDetails
DB01142DoxepinapprovedyesantagonistDetails
DB01151DesipramineapprovedyesantagonistDetails
DB00458ImipramineapprovedunknownantagonistDetails
DB00540NortriptylineapprovedyesantagonistDetails
DB00409Remoxiprideapproved, withdrawnunknownother/unknownDetails
DB00726TrimipramineapprovedunknownagonistDetails
DB01392Yohimbineapproved, vet_approvedunknownantagonistDetails
DB01079Tegaserodinvestigational, withdrawnunknownantagonistDetails
DB04842Fluspirileneapproved, investigationalunknownantagonistDetails
DB06288Amisulprideapproved, investigationalunknownantagonistDetails
DB01614Acepromazineapproved, vet_approvedyesantagonistDetails
DB01621Pipotiazineapproved, investigationalyesantagonistDetails
DB01622ThioproperazineapprovedyesantagonistDetails
DB01623ThiothixeneapprovedyesantagonistDetails
DB01454Midomafetamineexperimental, illicit, investigationalunknownagonistDetails
DB08810Cinitaprideapproved, investigationalyesantagonistDetails
DB08815LurasidoneapprovedyesantagonistDetails
DB08927AmperozideexperimentalunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00934MaprotilineapprovedunknownbinderDetails
DB09016ButriptylineapprovedyesantagonistDetails
DB09128BrexpiprazoleapprovedyesantagonistDetails
DB06016CariprazineapprovedyesantagonistDetails
DB08922Perospironeapprovedyesinverse agonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB00574Fenfluramineillicit, investigational, withdrawnunknownDetails
DB12465Ketanserininvestigationalunknowninverse agonistDetails
DB12693Ritanserininvestigationalunknowninverse agonistDetails
DB12163Sarpogrelateinvestigationalunknowninverse agonistDetails
DB00623FluphenazineapprovedunknownDetails
DB015374-Bromo-2,5-dimethoxyphenethylamineexperimental, illicitunknownpartial agonistDetails
DB09194EtoperidonewithdrawnyesantagonistDetails
DB01049Ergoloid mesylateapprovedunknownantagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB09304SetiptilineapprovedunknownantagonistDetails
DB00477Chlorpromazineapproved, vet_approvedunknownbinderDetails
DB01221Ketamineapproved, vet_approvedunknownantagonistDetails
DB06678Esmirtazapineinvestigationalunknowninverse agonistDetails