Somatostatin receptor type 2

Details

Name
Somatostatin receptor type 2
Synonyms
  • SRIF-1
  • SS-2-R
Gene Name
SSTR2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006800|Somatostatin receptor type 2
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Number of residues
369
Molecular Weight
41332.37
Theoretical pI
9.18
GO Classification
Functions
neuropeptide binding / PDZ domain binding / somatostatin receptor activity
Processes
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / cell-cell signaling / cellular response to estradiol stimulus / cellular response to glucocorticoid stimulus / cerebellum development / digestion / forebrain development / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / negative regulation of cell proliferation / neuropeptide signaling pathway / peristalsis / regulation of muscle contraction / response to nutrient / response to starvation / somatostatin signaling pathway / spermatogenesis / synaptic transmission
Components
cytoplasm / integral component of plasma membrane / neuron projection / plasma membrane
General Function
Somatostatin receptor activity
Specific Function
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
Pfam Domain Function
Transmembrane Regions
44-67 79-103 119-138 162-181 208-229 254-278 289-303
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017130|Somatostatin receptor type 2 (SSTR2)
ATGGACATGGCGGATGAGCCACTCAATGGAAGCCACACATGGCTATCCATTCCATTTGAC
CTCAATGGCTCTGTGGTGTCAACCAACACCTCAAACCAGACAGAGCCGTACTATGACCTG
ACAAGCAATGCAGTCCTCACATTCATCTATTTTGTGGTCTGCATCATTGGGTTGTGTGGC
AACACACTTGTCATTTATGTCATCCTCCGCTATGCCAAGATGAAGACCATCACCAACATT
TACATCCTCAACCTGGCCATCGCAGATGAGCTCTTCATGCTGGGTCTGCCTTTCTTGGCT
ATGCAGGTGGCTCTGGTCCACTGGCCCTTTGGCAAGGCCATTTGCCGGGTGGTCATGACT
GTGGATGGCATCAATCAGTTCACCAGCATCTTCTGCCTGACAGTCATGAGCATCGACCGA
TACCTGGCTGTGGTCCACCCCATCAAGTCGGCCAAGTGGAGGAGACCCCGGACGGCCAAG
ATGATCACCATGGCTGTGTGGGGAGTCTCTCTGCTGGTCATCTTGCCCATCATGATATAT
GCTGGGCTCCGGAGCAACCAGTGGGGGAGAAGCAGCTGCACCATCAACTGGCCAGGTGAA
TCTGGGGCTTGGTACACAGGGTTCATCATCTACACTTTCATTCTGGGGTTCCTGGTACCC
CTCACCATCATCTGTCTTTGCTACCTGTTCATTATCATCAAGGTGAAGTCCTCTGGAATC
CGAGTGGGCTCCTCTAAGAGGAAGAAGTCTGAGAAGAAGGTCACCCGAATGGTGTCCATC
GTGGTGGCTGTCTTCATCTTCTGCTGGCTTCCCTTCTACATATTCAACGTTTCTTCCGTC
TCCATGGCCATCAGCCCCACCCCAGCCCTTAAAGGCATGTTTGACTTTGTGGTGGTCCTC
ACCTATGCTAACAGCTGTGCCAACCCTATCCTATATGCCTTCTTGTCTGACAACTTCAAG
AAGAGCTTCCAGAATGTCCTCTGCTTGGTCAAGGTGAGCGGCACAGATGATGGGGAGCGG
AGTGACAGTAAGCAGGACAAATCCCGGCTGAATGAGACCACGGAGACCCAGAGGACCCTC
CTCAATGGAGACCTCCAAACCAGTATCTGA
Chromosome Location
17
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP30874
UniProtKB Entry NameSSR2_HUMAN
GenBank Gene IDBC095495
GenAtlas IDSSTR2
HGNC IDHGNC:11331
General References
  1. Yamada Y, Post SR, Wang K, Tager HS, Bell GI, Seino S: Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney. Proc Natl Acad Sci U S A. 1992 Jan 1;89(1):251-5. [Article]
  2. Petersenn S, Rasch AC, Presch S, Beil FU, Schulte HM: Genomic structure and transcriptional regulation of the human somatostatin receptor type 2. Mol Cell Endocrinol. 1999 Nov 25;157(1-2):75-85. [Article]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Patel YC, Greenwood M, Kent G, Panetta R, Srikant CB: Multiple gene transcripts of the somatostatin receptor SSTR2: tissue selective distribution and cAMP regulation. Biochem Biophys Res Commun. 1993 Apr 15;192(1):288-94. [Article]
  6. Zitzer H, Honck HH, Bachner D, Richter D, Kreienkamp HJ: Somatostatin receptor interacting protein defines a novel family of multidomain proteins present in human and rodent brain. J Biol Chem. 1999 Nov 12;274(46):32997-3001. [Article]
  7. Grant M, Collier B, Kumar U: Agonist-dependent dissociation of human somatostatin receptor 2 dimers: a role in receptor trafficking. J Biol Chem. 2004 Aug 27;279(35):36179-83. Epub 2004 Jul 1. [Article]
  8. Grant M, Alturaihi H, Jaquet P, Collier B, Kumar U: Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Mol Endocrinol. 2008 Oct;22(10):2278-92. doi: 10.1210/me.2007-0334. Epub 2008 Jul 24. [Article]
  9. Le Verche V, Kaindl AM, Verney C, Csaba Z, Peineau S, Olivier P, Adle-Biassette H, Leterrier C, Vitalis T, Renaud J, Dargent B, Gressens P, Dournaud P: The somatostatin 2A receptor is enriched in migrating neurons during rat and human brain development and stimulates migration and axonal outgrowth. PLoS One. 2009;4(5):e5509. doi: 10.1371/journal.pone.0005509. Epub 2009 May 12. [Article]
  10. Kailey B, van de Bunt M, Cheley S, Johnson PR, MacDonald PE, Gloyn AL, Rorsman P, Braun M: SSTR2 is the functionally dominant somatostatin receptor in human pancreatic beta- and alpha-cells. Am J Physiol Endocrinol Metab. 2012 Nov 1;303(9):E1107-16. doi: 10.1152/ajpendo.00207.2012. Epub 2012 Aug 28. [Article]
  11. Parry JJ, Chen R, Andrews R, Lears KA, Rogers BE: Identification of critical residues involved in ligand binding and G protein signaling in human somatostatin receptor subtype 2. Endocrinology. 2012 Jun;153(6):2747-55. doi: 10.1210/en.2011-1662. Epub 2012 Apr 11. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06663PasireotideapprovedunknownDetails
DB04894Vapreotideexperimental, investigationalyesinducerDetails
DB06791LanreotideapprovedunknownagonistDetails
DB13925Dotatate gallium Ga-68approved, investigationalyesbinderDetails
DB13985Lutetium Lu 177 dotatateapproved, investigationalyesagonistDetails
DB09099Somatostatinapproved, investigationalyesagonistDetails
DB15494Edotreotide gallium Ga-68approvedyesligandDetails
DB15873Copper oxodotreotide Cu-64approvedyesbinderDetails