Sodium-dependent serotonin transporter

Details

Name
Sodium-dependent serotonin transporter
Synonyms
  • 5HT transporter
  • 5HTT
  • HTT
  • SERT
  • Solute carrier family 6 member 4
Gene Name
SLC6A4
Organism
Human
Amino acid sequence
>lcl|BSEQ0001494|Sodium-dependent serotonin transporter
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Number of residues
630
Molecular Weight
70324.165
Theoretical pI
6.17
GO Classification
Functions
serotonin transmembrane transporter activity / serotonin / monoamine transmembrane transporter activity / cocaine binding / Rab GTPase binding / actin filament binding
Processes
protein homooligomerization / response to drug / circadian rhythm / vasoconstriction / serotonin uptake / synaptic transmission / monoamine transport / protein oligomerization / response to toxic substance / positive regulation of cell cycle / negative regulation of cerebellar granule cell precursor proliferation / thalamus development / negative regulation of neuron differentiation / negative regulation of synaptic transmission, dopaminergic / social behavior / cellular response to retinoic acid / serotonin transport / sperm ejaculation / response to estradiol / memory / cellular response to cGMP / response to hypoxia / response to nutrient / brain morphogenesis / positive regulation of gene expression / negative regulation of organ growth
Components
endosome membrane / plasma membrane / cytosol / integral component of plasma membrane / endomembrane system / membrane raft / neuron projection
General Function
Serotonin:sodium symporter activity
Specific Function
Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
Pfam Domain Function
Transmembrane Regions
88-108 116-135 160-180 253-271 280-297 333-350 362-383 417-436 464-482 498-518 539-558 577-595
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021275|Sodium-dependent serotonin transporter (SLC6A4)
ATGGAGACGACGCCCTTGAATTCTCAGAAGCAGCTATCAGCGTGTGAAGATGGAGAAGAT
TGTCAGGAAAACGGAGTTCTACAGAAGGTTGTTCCCACCCCAGGGGACAAAGTGGAGTCC
GGGCAAATATCCAATGGGTACTCAGCAGTTCCAAGTCCTGGTGCGGGAGATGACACACGG
CACTCTATCCCAGCGACCACCACCACCCTAGTGGCTGAGCTTCATCAAGGGGAACGGGAG
ACCTGGGGCAAGAAGGTGGATTTCCTTCTCTCAGTGATTGGCTATGCTGTGGACCTGGGC
AATGTCTGGCGCTTCCCCTACATATGTTACCAGAATGGAGGGGGGGCATTCCTCCTCCCC
TACACCATCATGGCCATTTTTGGGGGAATCCCGCTCTTTTACATGGAGCTCGCACTGGGA
CAGTACCACCGAAATGGATGCATTTCAATATGGAGGAAAATCTGCCCGATTTTCAAAGGG
ATTGGTTATGCCATCTGCATCATTGCCTTTTACATTGCTTCCTACTACAACACCATCATG
GCCTGGGCGCTATACTACCTCATCTCCTCCTTCACGGACCAGCTGCCCTGGACCAGCTGC
AAGAACTCCTGGAACACTGGCAACTGCACCAATTACTTCTCCGAGGACAACATCACCTGG
ACCCTCCATTCCACGTCCCCTGCTGAAGAATTTTACACGCGCCACGTCCTGCAGATCCAC
CGGTCTAAGGGGCTCCAGGACCTGGGGGGCATCAGCTGGCAGCTGGCCCTCTGCATCATG
CTGATCTTCACTGTTATCTACTTCAGCATCTGGAAAGGCGTCAAGACCTCTGGCAAGGTG
GTGTGGGTGACAGCCACCTTCCCTTATATCATCCTTTCTGTCCTGCTGGTGAGGGGTGCC
ACCCTCCCTGGAGCCTGGAGGGGTGTTCTCTTCTACTTGAAACCCAATTGGCAGAAACTC
CTGGAGACAGGGGTGTGGATAGATGCAGCCGCTCAGATCTTCTTCTCTCTTGGTCCGGGC
TTTGGGGTCCTGCTGGCTTTTGCTAGCTACAACAAGTTCAACAACAACTGCTACCAAGAT
GCCCTGGTGACCAGCGTGGTGAACTGCATGACGAGCTTCGTTTCGGGATTTGTCATCTTC
ACAGTGCTCGGTTACATGGCTGAGATGAGGAATGAAGATGTGTCTGAGGTGGCCAAAGAC
GCAGGTCCCAGCCTCCTCTTCATCACGTATGCAGAAGCGATAGCCAACATGCCAGCGTCC
ACTTTCTTTGCCATCATCTTCTTTCTGATGTTAATCACGCTGGGCTTGGACAGCACGTTT
GCAGGCTTGGAGGGGGTGATCACGGCTGTGCTGGATGAGTTCCCACACGTCTGGGCCAAG
CGCCGGGAGCGGTTCGTGCTCGCCGTGGTCATCACCTGCTTCTTTGGATCCCTGGTCACC
CTGACTTTTGGAGGGGCCTACGTGGTGAAGCTGCTGGAGGAGTATGCCACGGGGCCCGCA
GTGCTCACTGTCGCGCTGATCGAAGCAGTCGCTGTGTCTTGGTTCTATGGCATCACTCAG
TTCTGCAGGGACGTGAAGGAAATGCTCGGCTTCAGCCCGGGGTGGTTCTGGAGGATCTGC
TGGGTGGCCATCAGCCCTCTGTTTCTCCTGTTCATCATTTGCAGTTTTCTGATGAGCCCG
CCACAACTACGACTTTTCCAATATAATTATCCTTACTGGAGTATCATCTTGGGTTACTGC
ATAGGAACCTCATCTTTCATTTGCATCCCCACATATATAGCTTATCGGTTGATCATCACT
CCAGGGACATTTAAAGAGCGTATTATTAAAAGTATTACCCCAGAAACACCAACAGAAATT
CCTTGTGGGGACATCCGCTTGAATGCTGTGTAA
Chromosome Location
17
Locus
17q11.1-q12
External Identifiers
ResourceLink
UniProtKB IDP31645
UniProtKB Entry NameSC6A4_HUMAN
GenBank Protein ID36433
GenBank Gene IDX70697
GenAtlas IDSLC6A4
HGNC IDHGNC:11050
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00176Fluvoxamineapproved, investigationalyesinhibitorDetails
DB00215CitalopramapprovedyesinhibitorDetails
DB00285VenlafaxineapprovedyesinhibitorDetails
DB00321AmitriptylineapprovedyesinhibitorDetails
DB00472Fluoxetineapproved, vet_approvedyesinhibitorDetails
DB00476DuloxetineapprovedyesinhibitorDetails
DB00540NortriptylineapprovedyesinhibitorDetails
DB00543AmoxapineapprovedyesinhibitorDetails
DB00715Paroxetineapproved, investigationalyesinhibitorDetails
DB00726TrimipramineapprovedyesinhibitorDetails
DB01104SertralineapprovedyesinhibitorDetails
DB01105Sibutramineapproved, illicit, investigational, withdrawnyesinhibitorDetails
DB01142DoxepinapprovedyesinhibitorDetails
DB01175Escitalopramapproved, investigationalyesinhibitorDetails
DB01191Dexfenfluramineapproved, illicit, investigational, withdrawnyesinhibitorDetails
DB01242Clomipramineapproved, vet_approvedyesinhibitorDetails
DB00344ProtriptylineapprovedyesinhibitorDetails
DB00458ImipramineapprovedyesinhibitorDetails
DB00514DextromethorphanapprovedunknowninhibitorDetails
DB00656Trazodoneapproved, investigationalyesinhibitorDetails
DB00805MinaprineapprovedunknowninhibitorDetails
DB00907Cocaineapproved, illicityesinhibitorDetails
DB01149Nefazodoneapproved, withdrawnyesinhibitorDetails
DB01151DesipramineapprovedyesinhibitorDetails
DB00422Methylphenidateapproved, investigationalunknowninhibitorDetails
DB01454Midomafetamineexperimental, illicit, investigationalyesnegative modulatorDetails
DB04832ZimelidinewithdrawnunknownDetails
DB04836Amineptineillicit, withdrawnunknownDetails
DB01442MMDAexperimental, illicityesnegative modulatorDetails
DB00191Phentermineapproved, illicityesinhibitorDetails
DB04889BicifadineinvestigationalunknownDetails
DB04896MilnacipranapprovedyesinhibitorDetails
DB05422OPC-14523investigationalunknownDetails
DB05688CRx-119investigationalunknownDetails
DB00193Tramadolapproved, investigationalyesinhibitorDetails
DB12305DasotralineinvestigationalunknownDetails
DB06148Mianserinapproved, investigationalunknowninhibitorDetails
DB00289AtomoxetineapprovedunknownDetails
DB00661Verapamilapprovedunknownother/unknownDetails
DB00579MazindolapprovedyesinhibitorDetails
DB01114ChlorphenamineapprovedunknowninhibitorDetails
DB00574Fenfluramineillicit, investigational, withdrawnyesinhibitorDetails
DB01079Tegaserodinvestigational, withdrawnunknownsubstrateinhibitorDetails
DB06700DesvenlafaxineapprovedyesinhibitorDetails
DB06701DexmethylphenidateapprovedunknowninhibitorDetails
DB00852PseudoephedrineapprovedyesinhibitorDetails
DB014724-Methoxyamphetamineexperimental, illicityesinhibitorDetails
DB01577Methamphetamineapproved, illicityesnegative modulatorDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesnegative modulatorDetails
DB01454Midomafetamineexperimental, illicit, investigationalunknownDetails
DB06204TapentadolapprovedunknowninhibitorDetails
DB06684VilazodoneapprovedyesDetails
DB00215CitalopramapprovedunknownsubstrateinhibitorDetails
DB08918LevomilnacipranapprovedyesinhibitorDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB00182Amphetamineapproved, illicitunknownbinderDetails
DB00988DopamineapprovedunknownDetails
DB00454PethidineapprovedunknownbindingDetails
DB09016ButriptylineapprovedyesantagonistinhibitorDetails
DB09068VortioxetineapprovedyesinhibitorDetails
DB09167DosulepinapprovedyesinhibitorDetails
DB09186NisoxetineexperimentalunknownDetails
DB04821NomifensinewithdrawnunknownDetails
DB09289Tianeptineapproved, investigationalunknownDetails
DB09194EtoperidonewithdrawnyesinhibitorDetails