Low affinity immunoglobulin gamma Fc region receptor II-b

Details

Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Synonyms
  • CD32
  • CDw32
  • Fc-gamma RII-b
  • Fc-gamma-RIIb
  • FCG2
  • FcRII-b
  • IGFR2
  • IgG Fc receptor II-b
Gene Name
FCGR2B
Organism
Human
Amino acid sequence
>lcl|BSEQ0004116|Low affinity immunoglobulin gamma Fc region receptor II-b
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
Number of residues
310
Molecular Weight
34043.355
Theoretical pI
6.12
GO Classification
Processes
signal transduction / immune response / regulation of immune response / viral process
Components
plasma membrane / integral component of membrane
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
Pfam Domain Function
Transmembrane Regions
218-240
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019237|Low affinity immunoglobulin gamma Fc region receptor II-b (FCGR2B)
ATGGGAATCCTGTCATTCTTACCTGTCCTTGCCACTGAGAGTGACTGGGCTGACTGCAAG
TCCCCCCAGCCTTGGGGTCATATGCTTCTGTGGACAGCTGTGCTATTCCTGGCTCCTGTT
GCTGGGACACCTGCTCCCCCAAAGGCTGTGCTGAAACTCGAGCCCCAGTGGATCAACGTG
CTCCAGGAGGACTCTGTGACTCTGACATGCCGGGGGACTCACAGCCCTGAGAGCGACTCC
ATTCAGTGGTTCCACAATGGGAATCTCATTCCCACCCACACGCAGCCCAGCTACAGGTTC
AAGGCCAACAACAATGACAGCGGGGAGTACACGTGCCAGACTGGCCAGACCAGCCTCAGC
GACCCTGTGCATCTGACTGTGCTTTCTGAGTGGCTGGTGCTCCAGACCCCTCACCTGGAG
TTCCAGGAGGGAGAAACCATCGTGCTGAGGTGCCACAGCTGGAAGGACAAGCCTCTGGTC
AAGGTCACATTCTTCCAGAATGGAAAATCCAAGAAATTTTCCCGTTCGGATCCCAACTTC
TCCATCCCACAAGCAAACCACAGTCACAGTGGTGATTACCACTGCACAGGAAACATAGGC
TACACGCTGTACTCATCCAAGCCTGTGACCATCACTGTCCAAGCTCCCAGCTCTTCACCG
ATGGGGATCATTGTGGCTGTGGTCACTGGGATTGCTGTAGCGGCCATTGTTGCTGCTGTA
GTGGCCTTGATCTACTGCAGGAAAAAGCGGATTTCAGCCAATCCCACTAATCCTGATGAG
GCTGACAAAGTTGGGGCTGAGAACACAATCACCTATTCACTTCTCATGCACCCGGATGCT
CTGGAAGAGCCTGATGACCAGAACCGTATTTAG
Chromosome Location
1
Locus
1q23
External Identifiers
ResourceLink
UniProtKB IDP31994
UniProtKB Entry NameFCG2B_HUMAN
GenBank Protein ID4099445
GenBank Gene IDU87560
GenAtlas IDFCGR2B
HGNC IDHGNC:3618
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00002CetuximabapprovedunknownDetails
DB00005Etanerceptapproved, investigationalunknownDetails
DB00028Immune Globulin Humanapproved, investigationalyesantagonistDetails
DB00054AbciximabapprovedunknownDetails
DB00056Gemtuzumab ozogamicinapproved, investigationalunknownDetails
DB00072Trastuzumabapproved, investigationalunknownDetails
DB00074Basiliximabapproved, investigationalunknownDetails
DB00075Muromonabapproved, investigationalunknownDetails
DB00078Ibritumomab tiuxetanapproved, investigationalunknownDetails
DB00081Tositumomabapproved, investigationalunknownDetails
DB00087Alemtuzumabapproved, investigationalunknownDetails
DB00092Alefaceptapproved, investigational, withdrawnunknownDetails
DB00095Efalizumabapproved, investigationalunknownDetails
DB00108Natalizumabapproved, investigationalunknownDetails
DB00110Palivizumabapproved, investigationalunknownDetails
DB00111Daclizumabinvestigational, withdrawnunknownDetails
DB00112Bevacizumabapproved, investigationalunknownDetails
DB00098Antithymocyte immunoglobulin (rabbit)approvedyesDetails
DB11767Sarilumabapproved, investigationalunknownunknownDetails