Cytochrome P450 2C18

Details

Name
Cytochrome P450 2C18
Synonyms
  • 1.14.14.1
  • CYPIIC18
  • Cytochrome P450-6b/29c
Gene Name
CYP2C18
Organism
Human
Amino acid sequence
>lcl|BSEQ0006947|Cytochrome P450 2C18
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKV
YGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRW
KEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICS
VIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYI
KSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTE
TTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYID
LLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVP
PLYQLCFIPV
Number of residues
490
Molecular Weight
55710.075
Theoretical pI
7.22
GO Classification
Functions
iron ion binding / heme binding / monooxygenase activity / aromatase activity / arachidonic acid epoxygenase activity / oxygen binding / steroid hydroxylase activity / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Processes
epoxygenase P450 pathway / exogenous drug catabolic process / small molecule metabolic process / oxidation-reduction process / xenobiotic metabolic process
Components
cytoplasm / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Steroid hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0012511|Cytochrome P450 2C18 (CYP2C18)
ATGGATCCAGCTGTGGCTCTGGTGCTCTGTCTCTCCTGTTTGTTTCTCCTTTCACTCTGG
AGGCAGAGCTCTGGAAGAGGGAGGCTCCCGTCTGGCCCCACTCCTCTCCCGATTATTGGA
AATATCCTGCAGTTAGATGTTAAGGACATGAGCAAATCCTTAACCAATTTCTCAAAAGTC
TATGGCCCTGTGTTCACTGTGTATTTTGGCCTGAAGCCCATTGTGGTGTTGCATGGATAT
GAAGCAGTGAAGGAGGCCCTGATTGATCATGGAGAGGAGTTTTCTGGAAGAGGAAGTTTT
CCAGTGGCTGAAAAAGTTAACAAAGGACTTGGAATCCTTTTCAGCAATGGAAAGAGATGG
AAGGAGATCCGGCGTTTCTGCCTCATGACTCTGCGGAATTTTGGGATGGGGAAGAGGAGC
ATCGAGGACCGTGTTCAAGAGGAAGCCCGCTGCCTTGTGGAGGAGTTGAGAAAAACCAAT
GCCTCACCCTGTGATCCCACTTTCATCCTGGGCTGTGCTCCCTGCAATGTGATCTGCTCT
GTTATTTTCCATGATCGATTTGATTATAAAGATCAGAGGTTTCTTAACTTGATGGAAAAA
TTCAATGAAAACCTCAGGATTCTGAGCTCTCCATGGATCCAGGTCTGCAATAATTTCCCT
GCTCTCATCGATTATCTCCCAGGAAGTCATAATAAAATAGCTGAAAATTTTGCTTACATT
AAAAGTTATGTATTGGAGAGAATAAAAGAACATCAAGAATCCCTGGACATGAACAGTGCT
CGGGACTTTATTGATTGTTTCCTGATCAAAATGGAACAGGAAAAGCACAATCAACAGTCT
GAATTTACTGTTGAAAGCTTGATAGCCACTGTAACTGATATGTTTGGGGCTGGAACAGAG
ACAACGAGCACCACTCTGAGATATGGACTCCTGCTCCTGCTGAAGTACCCAGAGGTCACA
GCTAAAGTCCAGGAAGAGATTGAATGTGTAGTTGGCAGAAACCGGAGCCCCTGTATGCAG
GACAGGAGTCACATGCCCTACACAGATGCTGTGGTGCACGAGATCCAGAGATACATTGAC
CTCCTCCCCACCAACCTGCCCCATGCAGTGACCTGTGATGTTAAATTCAAAAACTACCTC
ATCCCCAAGGGCACGACCATAATAACATCCCTGACTTCTGTGCTGCACAATGACAAAGAA
TTCCCCAACCCAGAGATGTTTGACCCTGGCCACTTTCTGGATAAGAGTGGCAACTTTAAG
AAAAGTGACTACTTCATGCCTTTCTCAGCAGGAAAACGGATGTGTATGGGAGAGGGCCTG
GCCCGCATGGAGCTGTTTTTATTCCTGACCACCATTTTGCAGAACTTTAACCTGAAATCT
CAGGTTGACCCAAAGGATATTGACATCACCCCCATTGCCAATGCATTTGGTCGTGTGCCA
CCCTTGTACCAGCTCTGCTTCATTCCTGTCTGA
Chromosome Location
10
Locus
10q24
External Identifiers
ResourceLink
UniProtKB IDP33260
UniProtKB Entry NameCP2CI_HUMAN
GenBank Gene IDM61853
HGNC IDHGNC:2620
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01075Diphenhydramineapproved, investigationalunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateDetails
DB01424Aminophenazoneapproved, withdrawnunknownsubstrateDetails
DB00682WarfarinapprovedunknownsubstrateDetails
DB00661VerapamilapprovedunknownsubstrateDetails
DB076704-METHYL-N-METHYL-N-(2-PHENYL-2H-PYRAZOL-3-YL)BENZENESULFONAMIDEexperimentalunknownDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00349Clobazamapproved, illicitunknownsubstrateDetails
DB01559Clotiazepamapproved, illicitunknownsubstrateDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB01151Desipramineapproved, investigationalunknownsubstrateDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB00458ImipramineapprovedunknownsubstrateDetails
DB00448Lansoprazoleapproved, investigationalunknownsubstrateDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknownsubstrateDetails
DB00850PerphenazineapprovedunknownsubstrateDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateDetails
DB00252Phenytoinapproved, vet_approvedunknownsubstrateDetails
DB00818Propofolapproved, investigational, vet_approvedunknownsubstrateDetails
DB01124Tolbutamideapproved, investigationalunknownsubstrateDetails
DB13179TroleandomycinapprovedunknowninhibitorDetails
DB00313Valproic Acidapproved, investigationalunknowninhibitorDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB06684VilazodoneapprovedunknownsubstrateDetails
DB00082PegvisomantapprovedunknowninhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB09166EtizolamapprovedunknownsubstrateDetails
DB08496(R)-warfarinexperimentalunknownsubstrateDetails
DB14055(S)-Warfarinexperimental, investigationalunknownsubstrateDetails