Light-harvesting protein B-800/820 beta chain
Details
- Name
- Light-harvesting protein B-800/820 beta chain
- Synonyms
- Antenna pigment protein beta chain
- LH3 complex subunit beta
- Gene Name
- Not Available
- Organism
- Rhodoblastus acidophilus
- Amino acid sequence
>lcl|BSEQ0012734|Light-harvesting protein B-800/820 beta chain AEVLTSEQAEELHKHVIDGTRVFLVIAAIAHFLAFTLTPWLH
- Number of residues
- 42
- Molecular Weight
- 4725.425
- Theoretical pI
- 6.05
- GO Classification
- Functionsbacteriochlorophyll binding / electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity / metal ion bindingProcessesphotosynthesis, light reaction / protein-chromophore linkageComponentsintegral component of membrane / plasma membrane / plasma membrane light-harvesting complex
- General Function
- Metal ion binding
- Specific Function
- Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers.
- Pfam Domain Function
- LHC (PF00556)
- Transmembrane Regions
- 15-37
- Cellular Location
- Cell inner membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P35094 UniProtKB Entry Name LHB1_RHOAC - General References
- McLuskey K, Prince SM, Cogdell RJ, Isaacs NW: The crystallographic structure of the B800-820 LH3 light-harvesting complex from the purple bacteria Rhodopseudomonas acidophila strain 7050. Biochemistry. 2001 Jul 31;40(30):8783-9. [Article]