Alpha-1A adrenergic receptor

Details

Name
Alpha-1A adrenergic receptor
Synonyms
  • ADRA1C
  • Alpha-1A adrenoceptor
  • Alpha-1A adrenoreceptor
  • Alpha-1C adrenergic receptor
  • Alpha-adrenergic receptor 1c
Gene Name
ADRA1A
Organism
Human
Amino acid sequence
>lcl|BSEQ0001000|Alpha-1A adrenergic receptor
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Number of residues
466
Molecular Weight
51486.005
Theoretical pI
9.23
GO Classification
Functions
alpha1-adrenergic receptor activity / protein heterodimerization activity
Processes
positive regulation of action potential / signal transduction / negative regulation of cell proliferation / positive regulation of ERK1 and ERK2 cascade / G-protein coupled receptor signaling pathway / aging / response to drug / positive regulation of smooth muscle contraction / response to hormone / smooth muscle contraction / positive regulation of MAPK cascade / intracellular signal transduction / positive regulation of protein kinase C signaling / cell-cell signaling / adenylate cyclase-activating adrenergic receptor signaling pathway / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of synaptic transmission, GABAergic / norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure / calcium ion transport into cytosol / positive regulation of cytosolic calcium ion concentration / activation of phospholipase C activity / negative regulation of Rho protein signal transduction / positive regulation of vasoconstriction / positive regulation of cardiac muscle contraction / apoptotic process
Components
nucleus / plasma membrane / cytosol / nuclear membrane / integral component of plasma membrane
General Function
Protein heterodimerization activity
Specific Function
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.
Pfam Domain Function
Transmembrane Regions
28-51 65-88 100-122 144-167 182-205 274-297 306-329
Cellular Location
Nucleus membrane
Gene sequence
>lcl|BSEQ0010352|Alpha-1A adrenergic receptor (ADRA1A)
ATGGTGTTTCTCTCGGGAAATGCTTCCGACAGCTCCAACTGCACCCAACCGCCGGCACCG
GTGAACATTTCCAAGGCCATTCTGCTCGGGGTGATCTTGGGGGGCCTCATTCTTTTCGGG
GTGCTGGGTAACATCCTAGTGATCCTCTCCGTAGCCTGTCACCGACACCTGCACTCAGTC
ACGCACTACTACATCGTCAACCTGGCGGTGGCCGACCTCCTGCTCACCTCCACGGTGCTG
CCCTTCTCCGCCATCTTCGAGGTCCTAGGCTACTGGGCCTTCGGCAGGGTCTTCTGCAAC
ATCTGGGCGGCAGTGGATGTGCTGTGCTGCACCGCGTCCATCATGGGCCTCTGCATCATC
TCCATCGACCGCTACATCGGCGTGAGCTACCCGCTGCGCTACCCAACCATCGTCACCCAG
AGGAGGGGTCTCATGGCTCTGCTCTGCGTCTGGGCACTCTCCCTGGTCATATCCATTGGA
CCCCTGTTCGGCTGGAGGCAGCCGGCCCCCGAGGACGAGACCATCTGCCAGATCAACGAG
GAGCCGGGCTACGTGCTCTTCTCAGCGCTGGGCTCCTTCTACCTGCCTCTGGCCATCATC
CTGGTCATGTACTGCCGCGTCTACGTGGTGGCCAAGAGGGAGAGCCGGGGCCTCAAGTCT
GGCCTCAAGACCGACAAGTCGGACTCGGAGCAAGTGACGCTCCGCATCCATCGGAAAAAC
GCCCCGGCAGGAGGCAGCGGGATGGCCAGCGCCAAGACCAAGACGCACTTCTCAGTGAGG
CTCCTCAAGTTCTCCCGGGAGAAGAAAGCGGCCAAAACGCTGGGCATCGTGGTCGGCTGC
TTCGTCCTCTGCTGGCTGCCTTTTTTCTTAGTCATGCCCATTGGGTCTTTCTTCCCTGAT
TTCAAGCCCTCTGAAACAGTTTTTAAAATAGTATTTTGGCTCGGATATCTAAACAGCTGC
ATCAACCCCATCATATACCCATGCTCCAGCCAAGAGTTCAAAAAGGCCTTTCAGAATGTC
TTGAGAATCCAGTGTCTCTGCAGAAAGCAGTCTTCCAAACATGCCCTGGGCTACACCCTG
CACCCGCCCAGCCAGGCCGTGGAAGGGCAACACAAGGACATGGTGCGCATCCCCGTGGGA
TCAAGAGAGACCTTCTACAGGATCTCCAAGACGGATGGCGTTTGTGAATGGAAATTTTTC
TCTTCCATGCCCCGTGGATCTGCCAGGATTACAGTGTCCAAAGACCAATCCTCCTGTACC
ACAGCCCGGGTGAGAAGTAAAAGCTTTTTGCAGGTCTGCTGCTGTGTAGGGCCCTCAACC
CCCAGCCTTGACAAGAACCATCAAGTTCCAACCATTAAGGTCCACACCATCTCCCTCAGT
GAGAACGGGGAGGAAGTCTAG
Chromosome Location
8
Locus
8p21-p11.2
External Identifiers
ResourceLink
UniProtKB IDP35348
UniProtKB Entry NameADA1A_HUMAN
GenBank Protein ID433201
GenBank Gene IDD25235
GenAtlas IDADRA1A
HGNC IDHGNC:277
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00211MidodrineapprovedyesagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00298DapiprazoleapprovedyesantagonistDetails
DB00346Alfuzosinapproved, investigationalyesantagonistDetails
DB00388PhenylephrineapprovedyesDetails
DB00457PrazosinapprovedyesantagonistDetails
DB00590DoxazosinapprovedyesantagonistDetails
DB00610Metaraminolapproved, investigationalyesagonistDetails
DB00668Epinephrineapproved, vet_approvedyesagonistDetails
DB00679Thioridazineapproved, withdrawnyesantagonistDetails
DB00696Ergotamineapprovedyespartial agonistDetails
DB00699Nicergolineapproved, investigationalyesantagonistDetails
DB00706Tamsulosinapproved, investigationalyesantagonistDetails
DB00723Methoxamineapproved, investigationalyesagonistDetails
DB00797Tolazolineapproved, vet_approvedyesantagonistDetails
DB00852PseudoephedrineapprovedyesagonistDetails
DB00875Flupentixolapproved, investigational, withdrawnyesantagonistDetails
DB00925PhenoxybenzamineapprovedyesantagonistDetails
DB00935Oxymetazolineapproved, investigationalyesagonistDetails
DB01136Carvedilolapproved, investigationalyesantagonistDetails
DB01162TerazosinapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00656Trazodoneapproved, investigationalnoantagonistDetails
DB00734Risperidoneapproved, investigationalunknownantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00831Trifluoperazineapproved, investigationalyesantagonistDetails
DB00865Benzphetamineapproved, illicityesagonistDetails
DB01069Promethazineapproved, investigationalunknownunknownDetails
DB01149Nefazodoneapproved, withdrawnnoantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB014724-Methoxyamphetamineexperimental, illicityesagonistDetails
DB01576Dextroamphetamineapproved, illicitunknownDetails
DB01579Phendimetrazineapproved, illicityesagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB04855DronedaroneapprovedunknownantagonistDetails
DB00751Epinastineapproved, investigationalunknownunknownDetails
DB06144Sertindoleapproved, investigational, withdrawnunknownDetails
DB05469R450investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB06694Xylometazolineapproved, investigationalyesagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB01267PaliperidoneapprovedunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB01364EphedrineapprovedunknownDetails
DB00964ApraclonidineapprovedyesagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB00450Droperidolapproved, vet_approvedyesantagonistDetails
DB01295BevantololapprovedunknownantagonistDetails
DB01624Zuclopenthixolapproved, investigationalunknownantagonistDetails
DB00321AmitriptylineapprovednoantagonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB00458ImipramineapprovednoantagonistDetails
DB00540NortriptylineapprovednoantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB01175Escitalopramapproved, investigationalunknownantagonistDetails
DB00726TrimipramineapprovedunknownantagonistDetails
DB00692PhentolamineapprovedyesantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedyesantagonistDetails
DB00449DipivefrinapprovedyesagonistDetails
DB01253ErgonovineapprovedyesagonistDetails
DB01614Acepromazineapproved, vet_approvedunknownantagonistDetails
DB01622ThioproperazineapprovedyesantagonistDetails
DB06711NaphazolineapprovedyesagonistDetails
DB06706IsomethepteneapprovedyesagonistDetails
DB06207SilodosinapprovedyesantagonistDetails
DB04946IloperidoneapprovedunknownantagonistDetails
DB00215CitalopramapprovedunknownbinderDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB00575ClonidineapprovedunknownagonistDetails
DB00800FenoldopamapprovedunknownDetails
DB00248CabergolineapprovedunknownbinderDetails
DB06764TetryzolineapprovedyesagonistDetails
DB09202CirazolineexperimentalyesagonistDetails
DB08950IndoraminwithdrawnunknownantagonistDetails
DB09239NiguldipineexperimentalunknownantagonistDetails
DB00908Quinidineapproved, investigationalunknownantagonistDetails
DB00661VerapamilapprovedunknownantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11124RacepinephrineapprovedyesagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB12278Propiverineapproved, investigationalyesantagonistDetails
DB04948Lofexidineapproved, investigationalnoagonistDetails
DB00598LabetalolapprovedyesantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB08922PerospironeapprovedunknownantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09203SynephrineexperimentalunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB09204ArotinololinvestigationalyesantagonistDetails
DB09286Pipamperoneapproved, investigationalunknownantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229Aranidipineapproved, investigationalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails