Prostaglandin G/H synthase 2

Details

Name
Prostaglandin G/H synthase 2
Synonyms
  • 1.14.99.1
  • COX-2
  • COX2
  • Cyclooxygenase-2
  • PGH synthase 2
  • PGHS-2
  • PHS II
  • Prostaglandin H2 synthase 2
  • Prostaglandin-endoperoxide synthase 2
Gene Name
PTGS2
Organism
Human
Amino acid sequence
>lcl|BSEQ0021832|Prostaglandin G/H synthase 2
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
Number of residues
604
Molecular Weight
68995.625
Theoretical pI
7.41
GO Classification
Functions
heme binding / metal ion binding / arachidonate 15-lipoxygenase activity / enzyme binding / peroxidase activity / prostaglandin-endoperoxide synthase activity / lipid binding
Processes
positive regulation of platelet-derived growth factor production / NAD metabolic process / cyclooxygenase pathway / ovulation / learning / response to fructose / vitamin metabolic process / negative regulation of cell cycle / prostaglandin metabolic process / positive regulation of prostaglandin biosynthetic process / bone mineralization / cellular response to UV / water-soluble vitamin metabolic process / positive regulation of nitric oxide biosynthetic process / positive regulation of vasoconstriction / small molecule metabolic process / embryo implantation / negative regulation of smooth muscle contraction / positive regulation of synaptic transmission, glutamatergic / positive regulation of smooth muscle cell proliferation / positive regulation of apoptotic process / response to lithium ion / response to glucocorticoid / cellular response to fluid shear stress / cellular response to hypoxia / response to fatty acid / positive regulation of brown fat cell differentiation / response to lipopolysaccharide / positive regulation of NF-kappaB import into nucleus / memory / cellular response to mechanical stimulus / positive regulation of fever generation / maintenance of blood-brain barrier / sensory perception of pain / response to tumor necrosis factor / response to drug / positive regulation of vascular endothelial growth factor production / response to estradiol / brown fat cell differentiation / positive regulation of synaptic plasticity / arachidonic acid metabolic process / positive regulation of transforming growth factor beta production / negative regulation of synaptic transmission, dopaminergic / negative regulation of cell proliferation / negative regulation of calcium ion transport / cellular response to ATP / lipoxygenase pathway / nicotinamide metabolic process / response to oxidative stress / hair cycle / positive regulation of smooth muscle contraction / response to vitamin D / angiogenesis / regulation of blood pressure / prostaglandin biosynthetic process / positive regulation of fibroblast growth factor production / regulation of inflammatory response / decidualization / movement of cell or subcellular component / response to manganese ion / positive regulation of cell migration involved in sprouting angiogenesis / inflammatory response
Components
cytoplasm / protein complex / neuron projection / nucleus / endoplasmic reticulum lumen / endoplasmic reticulum / caveola / endoplasmic reticulum membrane
General Function
Prostaglandin-endoperoxide synthase activity
Specific Function
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, phenotypic changes, resistance to apoptosis and tumor angiogenesis. In cancer cells, PTGS2 is a key step in the production of prostaglandin E2 (PGE2), which plays important roles in modulating motility, proliferation and resistance to apoptosis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Microsome membrane
Gene sequence
>lcl|BSEQ0021833|Prostaglandin G/H synthase 2 (PTGS2)
ATGCTCGCCCGCGCCCTGCTGCTGTGCGCGGTCCTGGCGCTCAGCCATACAGCAAATCCT
TGCTGTTCCCACCCATGTCAAAACCGAGGTGTATGTATGAGTGTGGGATTTGACCAGTAT
AAGTGCGATTGTACCCGGACAGGATTCTATGGAGAAAACTGCTCAACACCGGAATTTTTG
ACAAGAATAAAATTATTTCTGAAACCCACTCCAAACACAGTGCACTACATACTTACCCAC
TTCAAGGGATTTTGGAACGTTGTGAATAACATTCCCTTCCTTCGAAATGCAATTATGAGT
TATGTGTTGACATCCAGATCACATTTGATTGACAGTCCACCAACTTACAATGCTGACTAT
GGCTACAAAAGCTGGGAAGCCTTCTCTAACCTCTCCTATTATACTAGAGCCCTTCCTCCT
GTGCCTGATGATTGCCCGACTCCCTTGGGTGTCAAAGGTAAAAAGCAGCTTCCTGATTCA
AATGAGATTGTGGAAAAATTGCTTCTAAGAAGAAAGTTCATCCCTGATCCCCAGGGCTCA
AACATGATGTTTGCATTCTTTGCCCAGCACTTCACGCATCAGTTTTTCAAGACAGATCAT
AAGCGAGGGCCAGCTTTCACCAACGGGCTGGGCCATGGGGTGGACTTAAATCATATTTAC
GGTGAAACTCTGGCTAGACAGCGTAAACTGCGCCTTTTCAAGGATGGAAAAATGAAATAT
CAGATAATTGATGGAGAGATGTATCCTCCCACAGTCAAAGATACTCAGGCAGAGATGATC
TACCCTCCTCAAGTCCCTGAGCATCTACGGTTTGCTGTGGGGCAGGAGGTCTTTGGTCTG
GTGCCTGGTCTGATGATGTATGCCACAATCTGGCTGCGGGAACACAACAGAGTATGCGAT
GTGCTTAAACAGGAGCATCCTGAATGGGGTGATGAGCAGTTGTTCCAGACAAGCAGGCTA
ATACTGATAGGAGAGACTATTAAGATTGTGATTGAAGATTATGTGCAACACTTGAGTGGC
TATCACTTCAAACTGAAATTTGACCCAGAACTACTTTTCAACAAACAATTCCAGTACCAA
AATCGTATTGCTGCTGAATTTAACACCCTCTATCACTGGCATCCCCTTCTGCCTGACACC
TTTCAAATTCATGACCAGAAATACAACTATCAACAGTTTATCTACAACAACTCTATATTG
CTGGAACATGGAATTACCCAGTTTGTTGAATCATTCACCAGGCAAATTGCTGGCAGGGTT
GCTGGTGGTAGGAATGTTCCACCCGCAGTACAGAAAGTATCACAGGCTTCCATTGACCAG
AGCAGGCAGATGAAATACCAGTCTTTTAATGAGTACCGCAAACGCTTTATGCTGAAGCCC
TATGAATCATTTGAAGAACTTACAGGAGAAAAGGAAATGTCTGCAGAGTTGGAAGCACTC
TATGGTGACATCGATGCTGTGGAGCTGTATCCTGCCCTTCTGGTAGAAAAGCCTCGGCCA
GATGCCATCTTTGGTGAAACCATGGTAGAAGTTGGAGCACCATTCTCCTTGAAAGGACTT
ATGGGTAATGTTATATGTTCTCCTGCCTACTGGAAGCCAAGCACTTTTGGTGGAGAAGTG
GGTTTTCAAATCATCAACACTGCCTCAATTCAGTCTCTCATCTGCAATAACGTGAAGGGC
TGTCCCTTTACTTCATTCAGTGTTCCAGATCCAGAGCTCATTAAAACAGTCACCATCAAT
GCAAGTTCTTCCCGCTCCGGACTAGATGATATCAATCCCACAGTACTACTAAAAGAACGT
TCGACTGAACTGTAG
Chromosome Location
1
Locus
1q25.2-q25.3
External Identifiers
ResourceLink
UniProtKB IDP35354
UniProtKB Entry NamePGH2_HUMAN
GenBank Protein ID291988
GenBank Gene IDL15326
GenAtlas IDPTGS2
HGNC IDHGNC:9605
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00154Dihomo-gamma-linolenic acidinvestigational, nutraceuticalyesDetails
DB00159Icosapentapproved, nutraceuticalyesinhibitorDetails
DB00480Lenalidomideapprovedunknownnegative modulatorDetails
DB00482Celecoxibapproved, investigationalyesinhibitorDetails
DB00533Rofecoxibapproved, investigational, withdrawnyesinhibitorDetails
DB00580Valdecoxibapproved, investigational, withdrawnyesinhibitorDetails
DB00605Sulindacapproved, investigationalyesinhibitorDetails
DB00712Flurbiprofenapproved, investigationalyesinhibitorDetails
DB00784Mefenamic acidapprovedyesinhibitorDetails
DB00812Phenylbutazoneapproved, vet_approvedyesinhibitorDetails
DB00821Carprofenapproved, vet_approved, withdrawnyesinhibitorDetails
DB00991OxaprozinapprovedyesinhibitorDetails
DB00244MesalazineapprovedyesinhibitorDetails
DB00316AcetaminophenapprovedyesinhibitorDetails
DB00328Indometacinapproved, investigationalyesinhibitorDetails
DB00461NabumetoneapprovedyesinhibitorDetails
DB00465KetorolacapprovedyesinhibitorDetails
DB00469TenoxicamapprovedyesinhibitorDetails
DB00500TolmetinapprovedyesinhibitorDetails
DB00573FenoprofenapprovedyesinhibitorDetails
DB00586Diclofenacapproved, vet_approvedyesinhibitorDetails
DB00749Etodolacapproved, investigational, vet_approvedyesinhibitorDetails
DB00788Naproxenapproved, vet_approvedyesinhibitorDetails
DB00814Meloxicamapproved, vet_approvedyesinhibitorDetails
DB00861Diflunisalapproved, investigationalyesinhibitorDetails
DB00870Suprofenapproved, withdrawnyesinhibitorDetails
DB00939Meclofenamic acidapproved, vet_approvedyesinhibitorDetails
DB00945Acetylsalicylic acidapproved, vet_approvedyesinhibitorDetails
DB00963BromfenacapprovedyesinhibitorDetails
DB01009Ketoprofenapproved, vet_approvedyesinhibitorDetails
DB01014Balsalazideapproved, investigationalyesinhibitorDetails
DB01050IbuprofenapprovedyesinhibitorDetails
DB01283Lumiracoxibapproved, investigationalyesinhibitorDetails
DB01399SalsalateapprovedyesinhibitorDetails
DB00936Salicylic acidapproved, investigational, vet_approvedyesinhibitorDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownantagonistDetails
DB01404Ginsengapproved, investigational, nutraceuticalunknowninhibitorDetails
DB01628Etoricoxibapproved, investigationalyesinhibitorDetails
DB01600Tiaprofenic acidapprovedyesinhibitorDetails
DB04743Nimesulideapproved, investigational, withdrawnyesinhibitorDetails
DB02709Resveratrolapproved, experimental, investigationalunknowninhibitorDetails
DB04725LicofeloneinvestigationalunknownDetails
DB05095CimicoxibinvestigationalunknownDetails
DB02266Flufenamic AcidapprovedunknownDetails
DB00554Piroxicamapproved, investigationalyesinhibitorDetails
DB01397Magnesium salicylateapprovedyesinhibitorDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownsubstrateDetails
DB06725Lornoxicamapproved, investigationalyesinhibitorDetails
DB03866Prostaglandin G2experimentalunknownDetails
DB034771-Phenylsulfonamide-3-Trifluoromethyl-5-ParabromophenylpyrazoleexperimentalunknownDetails
DB06802Nepafenacapproved, investigationalunknowninhibitorDetails
DB00795SulfasalazineapprovedyesinhibitorDetails
DB04552Niflumic AcidexperimentalyesinhibitorDetails
DB01435Antipyrineapproved, investigationalunknowninhibitorDetails
DB01419AntrafenineapprovedunknowninhibitorDetails
DB01401Choline magnesium trisalicylateapprovedunknowninhibitorDetails
DB00233Aminosalicylic AcidapprovedunknowninhibitorDetails
DB00963BromfenacapprovedunknowninhibitorDetails
DB00887BumetanideapprovedunknowninducerDetails
DB06774CapsaicinapprovedunknowninhibitorDetails
DB00856Chlorphenesinapproved, experimentalunknowninhibitorDetails
DB05095CimicoxibinvestigationalunknowninhibitorDetails
DB00720Clodronic Acidapproved, investigational, vet_approvedunknowninhibitorDetails
DB06195SeliciclibinvestigationalunknowninhibitorDetails
DB00035DesmopressinapprovedunknowninducerDetails
DB05804Prasterone sulfateinvestigationalunknowninducerDetails
DB01395DrospirenoneapprovedunknowninhibitorDetails
DB06804Nonoxynol-9approved, withdrawnunknowninducerDetails
DB00515CisplatinapprovedunknowninhibitorDetails
DB00884Risedronateapproved, investigationalunknowninducerDetails
DB00360Sapropterinapproved, investigationalunknowninducerDetails
DB06436SemaxanibinvestigationalunknowninducerDetails
DB05875substance PinvestigationalunknowninducerDetails
DB00041AldesleukinapprovedunknowninducerDetails
DB00620Triamcinoloneapproved, vet_approvedunknowninhibitorDetails
DB08819TafluprostapprovedunknowninducerDetails
DB08910PomalidomideapprovedyesinhibitorDetails
DB00773EtoposideapprovedunknownsubstrateDetails
DB08439ParecoxibapprovedyesinhibitorDetails
DB09217Firocoxibexperimental, vet_approvedunknownDetails
DB13167Alclofenacapproved, withdrawnyesantagonistDetails
DB09213Dexibuprofenapproved, investigationalyesinhibitorDetails
DB11133Omega-3 fatty acidsapproved, nutraceuticalunknownsubstrateDetails
DB13168Omega-6 fatty acidsnutraceuticalunknownsubstrateDetails
DB06736Aceclofenacapproved, investigationalyesinhibitorDetails
DB13783Acemetacinapproved, experimental, investigationalyesantagonistDetails
DB09215DroxicamwithdrawnyesinhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB09212LoxoprofeninvestigationalyesantagonistDetails
DB09212LoxoprofeninvestigationalunknownsubstrateDetails
DB09216Tolfenamic Acidapproved, investigationalyesantagonistDetails
DB09214Dexketoprofenapproved, investigationalunknownantagonistDetails
DB09214Dexketoprofenapproved, investigationalunknowninhibitorDetails
DB09295TalniflumateexperimentalunknownantagonistDetails
DB09295TalniflumateexperimentalunknowninhibitorDetails
DB09285MorniflumateexperimentalunknownDetails
DB09285MorniflumateexperimentalunknowninhibitorDetails
DB09288PropacetamolexperimentalyesantagonistDetails
DB11079Trolamine salicylateapprovedyesinhibitorDetails
DB13257Ferrous sulfate anhydrousapprovedunknownDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB11071Phenyl salicylateapprovedunknownantagonistDetails
DB13346Bufexamacapproved, withdrawnyesinhibitorDetails
DB11327DipyrithioneapprovedunknownDetails
DB13961Fish oilapproved, nutraceuticalyesinhibitorDetails
DB11323Glycol salicylateapprovedyesantagonistDetails
DB11201Menthyl salicylateapprovedyesantagonistDetails
DB00210AdapaleneapprovedyesinhibitorDetails
DB13501Bendazacapproved, withdrawnunknownDetails