Alpha-1B adrenergic receptor

Details

Name
Alpha-1B adrenergic receptor
Synonyms
  • Alpha-1B adrenoceptor
  • Alpha-1B adrenoreceptor
Gene Name
ADRA1B
Organism
Human
Amino acid sequence
>lcl|BSEQ0010399|Alpha-1B adrenergic receptor
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Number of residues
520
Molecular Weight
56835.375
Theoretical pI
9.79
GO Classification
Functions
alpha1-adrenergic receptor activity / protein heterodimerization activity
Processes
adenylate cyclase-modulating G-protein coupled receptor signaling pathway / organ growth / G-protein coupled receptor signaling pathway / positive regulation of MAPK cascade / positive regulation of glycogen catabolic process / positive regulation of smooth muscle contraction / visual learning / regulation of cardiac muscle contraction / multicellular organismal development / response to morphine / cell growth / vasoconstriction of artery involved in baroreceptor response to lowering of systemic arterial blood pressure / intracellular signal transduction / adenylate cyclase-activating adrenergic receptor signaling pathway / cell-cell signaling / positive regulation of heart rate by epinephrine-norepinephrine / cell proliferation / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of the force of heart contraction by epinephrine-norepinephrine / locomotory behavior / behavioral response to cocaine / glucose homeostasis / response to amphetamine / blood vessel remodeling / norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure / adult heart development / positive regulation of cytosolic calcium ion concentration / positive regulation of vasoconstriction / negative regulation of glycogen catabolic process
Components
nucleus / plasma membrane / cytosol / nuclear membrane / integral component of plasma membrane
General Function
Protein heterodimerization activity
Specific Function
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes.
Pfam Domain Function
Transmembrane Regions
46-70 84-105 116-141 162-184 202-224 296-319 327-351
Cellular Location
Nucleus membrane
Gene sequence
>lcl|BSEQ0010400|Alpha-1B adrenergic receptor (ADRA1B)
ATGAATCCCGACCTGGACACCGGCCACAACACATCAGCACCTGCCCACTGGGGAGAGTTG
AAAAATGCCAACTTCACTGGCCCCAACCAGACCTCGAGCAACTCCACACTGCCCCAGCTG
GACATCACCAGGGCCATCTCTGTGGGCCTGGTGCTGGGCGCCTTCATCCTCTTTGCCATC
GTGGGCAACATCCTAGTCATCTTGTCTGTGGCCTGCAACCGGCACCTGCGGACGCCCACC
AACTACTTCATTGTCAACCTGGCCATGGCCGACCTGCTGTTGAGCTTCACCGTCCTGCCC
TTCTCAGCGGCCCTAGAGGTGCTCGGCTACTGGGTGCTGGGGCGGATCTTCTGTGACATC
TGGGCAGCCGTGGATGTCCTGTGCTGCACAGCGTCCATTCTGAGCCTGTGCGCCATCTCC
ATCGATCGCTACATCGGGGTGCGCTACTCTCTGCAGTATCCCACGCTGGTCACCCGGAGG
AAGGCCATCTTGGCGCTGCTCAGTGTCTGGGTCTTGTCCACCGTCATCTCCATCGGGCCT
CTCCTTGGGTGGAAGGAGCCGGCACCCAACGATGACAAGGAGTGCGGGGTCACCGAAGAA
CCCTTCTATGCCCTCTTCTCCTCTCTGGGCTCCTTCTACATCCCTCTGGCGGTCATTCTA
GTCATGTACTGCCGTGTCTATATAGTGGCCAAGAGAACCACCAAGAACCTAGAGGCAGGA
GTCATGAAGGAGATGTCCAACTCCAAGGAGCTGACCCTGAGGATCCATTCCAAGAACTTT
CACGAGGACACCCTTAGCAGTACCAAGGCCAAGGGCCACAACCCCAGGAGTTCCATAGCT
GTCAAACTTTTTAAGTTCTCCAGGGAAAAGAAAGCAGCTAAGACGTTGGGCATTGTGGTC
GGTATGTTCATCTTGTGCTGGCTACCCTTCTTCATCGCTCTACCGCTTGGCTCCTTGTTC
TCCACCCTGAAGCCCCCCGACGCCGTGTTCAAGGTGGTGTTCTGGCTGGGCTACTTCAAC
AGCTGCCTCAACCCCATCATCTACCCATGCTCCAGCAAGGAGTTCAAGCGCGCTTTCGTG
CGCATCCTCGGGTGCCAGTGCCGCGGCCGCGGCCGCCGCCGACGCCGCCGCCGCCGTCGC
CTGGGCGGCTGCGCCTACACCTACCGGCCGTGGACGCGCGGCGGCTCGCTGGAGCGCTCG
CAGTCGCGCAAGGACTCGCTGGACGACAGCGGCAGCTGCCTGAGCGGCAGCCAGCGGACC
CTGCCCTCGGCCTCGCCGAGCCCGGGCTACCTGGGCCGCGGCGCGCCACCGCCAGTCGAG
CTGTGCGCCTTCCCCGAGTGGAAGGCGCCCGGCGCCCTCCTGAGCCTGCCCGCGCCTGAG
CCCCCCGGCCGCCGCGGCCGCCACGACTCGGGCCCGCTCTTCACCTTCAAGCTCCTGACC
GAGCCCGAGAGCCCCGGGACCGACGGCGGCGCCAGCAACGGAGGCTGCGAGGCCGCGGCC
GACGTGGCCAACGGGCAGCCGGGCTTCAAAAGCAACATGCCCCTGGCGCCCGGGCAGTTT
TAG
Chromosome Location
5
Locus
5q23-q32
External Identifiers
ResourceLink
UniProtKB IDP35368
UniProtKB Entry NameADA1B_HUMAN
GenBank Gene IDM99589
GenAtlas IDADRA1B
HGNC IDHGNC:278
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00298DapiprazoleapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00706Tamsulosinapproved, investigationalunknownantagonistDetails
DB00745Modafinilapproved, investigationalunknownpartial agonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB01162TerazosinapprovedyesantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB00457PrazosinapprovedyesantagonistDetails
DB00723Methoxamineapproved, investigationalunknownagonistDetails
DB01608Propericiazineapproved, investigationalunknownantagonistDetails
DB01576Dextroamphetamineapproved, illicitunknownantagonistDetails
DB01579Phendimetrazineapproved, illicitunknownagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB00590DoxazosinapprovedyesantagonistDetails
DB00211MidodrineapprovedyesagonistDetails
DB01149Nefazodoneapproved, withdrawnunknownother/unknownDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB00388PhenylephrineapprovedyesDetails
DB00734Risperidoneapproved, investigationalunknownantagonistDetails
DB00346Alfuzosinapproved, investigationalyesantagonistDetails
DB04855DronedaroneapprovedunknownantagonistDetails
DB01255Lisdexamfetamineapproved, investigationalunknownantagonistDetails
DB06144Sertindoleapproved, investigational, withdrawnunknownDetails
DB05469R450investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB01267PaliperidoneapprovedunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB00726TrimipramineapprovedunknownantagonistDetails
DB00696Ergotamineapprovedyespartial agonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedyesantagonistDetails
DB00679Thioridazineapproved, withdrawnyesantagonistDetails
DB01614Acepromazineapproved, vet_approvedunknownantagonistDetails
DB01622ThioproperazineapprovedyesantagonistDetails
DB06694Xylometazolineapproved, investigationalunknownagonistDetails
DB00668Epinephrineapproved, vet_approvedyesagonistDetails
DB06207SilodosinapprovedunknownantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00458ImipramineapprovedunknownantagonistDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00575ClonidineapprovedunknownagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00800FenoldopamapprovedunknowninhibitorDetails
DB00248CabergolineapprovedunknownbinderDetails
DB00321AmitriptylineapprovedunknownantagonistDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB00935Oxymetazolineapproved, investigationalunknownagonistDetails
DB09202Cirazolineexperimentalyespartial agonistDetails
DB09128Brexpiprazoleapproved, investigationalyesantagonistDetails
DB00692PhentolamineapprovedunknownantagonistDetails
DB00908Quinidineapproved, investigationalunknownantagonistDetails
DB00661VerapamilapprovedunknownantagonistDetails
DB11124RacepinephrineapprovedyesagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB00598LabetalolapprovedyesantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB08922PerospironeapprovedunknownantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09203SynephrineexperimentalunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB09204ArotinololinvestigationalyesantagonistDetails
DB09286Pipamperoneapproved, investigationalunknownantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229Aranidipineapproved, investigationalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails