Metabotropic glutamate receptor 5

Details

Name
Metabotropic glutamate receptor 5
Synonyms
  • GPRC1E
  • MGLUR5
Gene Name
GRM5
Organism
Human
Amino acid sequence
>lcl|BSEQ0002371|Metabotropic glutamate receptor 5
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
Number of residues
1212
Molecular Weight
132467.635
Theoretical pI
7.82
GO Classification
Functions
G-protein coupled receptor activity / glutamate receptor activity
Processes
negative regulation of locomotion / phospholipase C-activating G-protein coupled glutamate receptor signaling pathway / cognition / positive regulation of long-term neuronal synaptic plasticity / learning / synaptic transmission / desensitization of G-protein coupled receptor protein signaling pathway / regulation of transcription, DNA-templated / regulation of synaptic transmission, glutamatergic / G-protein coupled glutamate receptor signaling pathway / protein phosphorylation / protein kinase C-activating G-protein coupled receptor signaling pathway / activation of MAPKKK activity / locomotory behavior
Components
cytoplasm / postsynaptic density / plasma membrane / astrocyte projection / extracellular exosome / dendritic spine / integral component of plasma membrane / dendritic shaft
General Function
Glutamate receptor activity
Specific Function
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system and generates a calcium-activated chloride current. Plays an important role in the regulation of synaptic plasticity and the modulation of the neural network activity.
Pfam Domain Function
Transmembrane Regions
581-603 614-636 645-667 694-714 738-759 773-795 799-820
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010830|Metabotropic glutamate receptor 5 (GRM5)
ATGGTCCTTCTGTTGATCCTGTCAGTCTTACTTTTGAAAGAAGATGTCCGTGGGAGTGCA
CAGTCCAGTGAGAGGAGGGTGGTGGCTCACATGCCGGGTGACATCATTATTGGAGCTCTC
TTTTCTGTTCATCACCAGCCTACTGTGGACAAAGTTCATGAGAGGAAGTGTGGGGCGGTC
CGTGAACAGTATGGCATTCAGAGAGTGGAGGCCATGCTGCATACCCTGGAAAGGATCAAT
TCAGACCCCACACTCTTGCCCAACATCACACTGGGCTGTGAGATAAGGGACTCCTGCTGG
CATTCGGCTGTGGCCCTAGAGCAGAGCATTGAGTTCATAAGAGATTCCCTCATTTCTTCA
GAAGAGGAAGAAGGCTTGGTACGCTGTGTGGATGGCTCCTCCTCTTCCTTCCGCTCCAAG
AAGCCCATAGTAGGGGTCATTGGGCCTGGCTCCAGTTCTGTAGCCATTCAGGTCCAGAAT
TTGCTCCAGCTTTTCAACATACCTCAGATTGCTTACTCAGCAACCAGCATGGATCTGAGT
GACAAGACTCTGTTCAAATATTTCATGAGGGTTGTGCCTTCAGATGCTCAGCAGGCAAGG
GCCATGGTGGACATAGTGAAGAGGTACAACTGGACCTATGTATCAGCCGTGCACACAGAA
GGCAACTATGGAGAAAGTGGGATGGAAGCCTTCAAAGATATGTCAGCGAAGGAAGGGATT
TGCATCGCCCACTCTTACAAAATCTACAGTAATGCAGGGGAGCAGAGCTTTGATAAGCTG
CTGAAGAAGCTCACAAGTCACTTGCCCAAGGCCCGGGTGGTGGCCTGCTTCTGTGAGGGC
ATGACGGTGAGAGGTCTGCTGATGGCCATGAGGCGCCTGGGTCTAGCGGGAGAATTTCTG
CTTCTGGGCAGTGATGGCTGGGCTGACAGGTATGATGTGACAGATGGATATCAGCGAGAA
GCTGTTGGTGGCATCACAATCAAGCTCCAATCTCCCGATGTCAAGTGGTTTGATGATTAT
TATCTGAAGCTCCGGCCAGAAACAAACCACCGAAACCCTTGGTTTCAAGAATTTTGGCAG
CATCGTTTTCAGTGCCGACTGGAAGGGTTTCCACAGGAGAACAGCAAATACAACAAGACT
TGCAATAGTTCTCTGACTCTGAAAACACATCATGTTCAGGATTCCAAAATGGGATTTGTG
ATCAACGCCATCTATTCGATGGCCTATGGGCTCCACAACATGCAGATGTCCCTCTGCCCA
GGCTATGCAGGACTCTGTGATGCCATGAAGCCAATTGATGGACGGAAACTTTTGGAGTCC
CTGATGAAAACCAATTTTACTGGGGTTTCTGGAGATACGATCCTATTCGATGAGAATGGA
GACTCTCCAGGAAGGTATGAAATAATGAATTTCAAGGAAATGGGAAAAGATTACTTTGAT
TATATCAACGTTGGAAGTTGGGACAATGGAGAATTAAAAATGGATGATGATGAAGTATGG
TCCAAGAAAAGCAACATCATCAGATCTGTGTGCAGTGAACCATGTGAGAAAGGCCAGATC
AAGGTGATCCGAAAGGGAGAAGTCAGCTGTTGTTGGACCTGTACACCTTGTAAGGAGAAT
GAGTATGTCTTTGATGAGTACACATGCAAGGCATGCCAACTGGGGTCTTGGCCCACTGAT
GATCTCACAGGTTGTGACTTGATCCCAGTACAGTATCTTCGATGGGGTGACCCTGAACCC
ATTGCAGCTGTGGTGTTTGCCTGCCTTGGCCTCCTGGCCACCCTGTTTGTTACTGTAGTC
TTCATCATTTACCGTGATACACCAGTAGTCAAGTCCTCAAGCAGGGAACTCTGCTACATT
ATCCTTGCTGGCATCTGCCTGGGCTACTTATGTACCTTCTGCCTCATTGCGAAGCCCAAA
CAGATTTACTGCTACCTTCAGAGAATTGGCATTGGTCTCTCCCCAGCCATGAGCTACTCA
GCCCTTGTAACAAAGACCAACCGTATTGCAAGGATCCTGGCTGGCAGCAAGAAGAAGATC
TGTACCAAAAAGCCCAGATTCATGAGTGCCTGTGCCCAGCTAGTGATTGCTTTCATTCTC
ATATGCATCCAGTTGGGCATCATCGTTGCCCTCTTTATAATGGAGCCTCCTGACATAATG
CATGACTACCCAAGCATTCGAGAAGTCTACCTGATCTGTAACACCACCAACCTAGGAGTT
GTCACTCCACTTGGATACAATGGATTGTTGATTTTGAGCTGCACCTTCTATGCGTTCAAG
ACCAGAAATGTTCCAGCTAACTTCAACGAGGCCAAGTATATCGCCTTCACAATGTACACG
ACCTGCATTATATGGCTAGCTTTTGTGCCAATCTACTTTGGCAGCAACTACAAAATCATC
ACCATGTGTTTCTCGGTCAGCCTCAGTGCCACAGTGGCCCTAGGCTGCATGTTTGTGCCG
AAGGTGTACATCATCCTGGCCAAACCAGAGAGAAACGTGCGCAGCGCCTTCACCACATCT
ACCGTGGTGCGCATGCATGTAGGGGATGGCAAGTCATCCTCCGCAGCCAGCAGATCCAGC
AGCCTAGTCAACCTGTGGAAGAGAAGGGGCTCCTCTGGGGAAACCTTAAGTTCCAATGGA
AAATCCGTCACGTGGGCCCAGAATGAGAAGAGCAGCCGGGGGCAGCACCTGTGGCAGCGC
CTGTCCATCCACATCAACAAGAAAGAAAACCCCAACCAAACGGCCGTCATCAAGCCCTTC
CCCAAGAGCACGGAGAGCCGTGGCCTGGGCGCTGGCGCTGGCGCAGGCGGGAGCGCTGGG
GGCGTGGGGGCCACGGGCGGTGCGGGCTGCGCAGGCGCCGGCCCAGGCGGGCCCGAGTCC
CCAGACGCCGGCCCCAAGGCGCTGTATGATGTGGCCGAGGCTGAGGAGCACTTCCCGGCG
CCCGCGCGGCCGCGCTCACCGTCGCCCATCAGCACGCTGAGCCACCGCGCGGGCTCGGCC
AGCCGCACGGACGACGATGTGCCGTCGCTGCACTCGGAGCCTGTGGCGCGCAGCAGCTCC
TCGCAGGGCTCCCTCATGGAGCAGATCAGCAGTGTGGTCACCCGCTTCACGGCCAACATC
AGCGAGCTCAACTCCATGATGCTGTCCACCGCGGCCCCCAGCCCCGGCGTCGGCGCCCCG
CTCTGCTCGTCCTACCTGATCCCCAAAGAGATCCAGTTGCCCACGACCATGACGACCTTT
GCCGAAATCCAGCCTCTGCCGGCCATCGAAGTCACGGGAGGCGCGCAGCCCGCGGCAGGG
GCGCAGGCGGCTGGGGACGCGGCCCGGGAGAGCCCCGCGGCCGGTCCCGAGGCTGCGGCC
GCCAAGCCAGACCTGGAGGAGCTGGTGGCTCTCACCCCGCCGTCCCCCTTCAGAGACTCG
GTGGACTCGGGGAGCACAACCCCCAACTCGCCAGTGTCCGAGTCGGCCCTCTGTATCCCG
TCGTCTCCCAAATATGACACTCTTATCATAAGAGATTACACTCAGAGCTCCTCGTCGTTG
TGA
Chromosome Location
11
Locus
11q14.2-q14.3
External Identifiers
ResourceLink
UniProtKB IDP41594
UniProtKB Entry NameGRM5_HUMAN
GenBank Protein ID1408052
GenBank Gene IDD28538
GenAtlas IDGRM5
HGNC IDHGNC:4597
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00659Acamprosateapproved, investigationalyesantagonistDetails
DB05070ADX10059investigationalunknownDetails
DB12733DipraglurantinvestigationalunknownDetails
DB06201RufinamideapprovedunknowninhibitorDetails