5-hydroxytryptamine receptor 2B

Details

Name
5-hydroxytryptamine receptor 2B
Synonyms
  • 5-HT-2B
  • Serotonin receptor 2B
Gene Name
HTR2B
Organism
Human
Amino acid sequence
>lcl|BSEQ0016078|5-hydroxytryptamine receptor 2B
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
Number of residues
481
Molecular Weight
54297.41
Theoretical pI
9.47
GO Classification
Functions
drug binding / GTPase activator activity / serotonin receptor activity / serotonin binding / G-protein alpha-subunit binding
Processes
positive regulation of nitric-oxide synthase activity / neural crest cell differentiation / positive regulation of phosphatidylinositol biosynthetic process / G-protein coupled receptor internalization / positive regulation of ERK1 and ERK2 cascade / release of sequestered calcium ion into cytosol / cardiac muscle hypertrophy / G-protein coupled receptor signaling pathway / response to drug / negative regulation of cell death / positive regulation of cytokine production / positive regulation of cell proliferation / neural crest cell migration / intestine smooth muscle contraction / positive regulation of cytokine secretion / protein kinase C-activating G-protein coupled receptor signaling pathway / positive regulation of endothelial cell proliferation / phosphorylation / regulation of behavior / calcium-mediated signaling / protein kinase C signaling / positive regulation of cell division / heart morphogenesis / behavior / embryonic morphogenesis / positive regulation of I-kappaB kinase/NF-kappaB signaling / serotonin receptor signaling pathway / cellular response to amine stimulus / ERK1 and ERK2 cascade / cellular calcium ion homeostasis / cellular response to serotonin / phosphatidylinositol 3-kinase signaling / ion transmembrane transport / negative regulation of autophagy / activation of phospholipase C activity / cellular response to temperature stimulus / vasoconstriction / negative regulation of apoptotic process / positive regulation of MAP kinase activity / hepatic stellate cell activation / cGMP biosynthetic process / inositol phosphate metabolic process
Components
synapse / cytoplasm / neuronal cell body / plasma membrane / cell junction / integral component of plasma membrane / dendrite
General Function
Serotonin receptor activity
Specific Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake and in the regulation of extracellular dopamine and 5-hydroxytryptamine levels, and thereby affects neural activity. May play a role in the perception of pain. Plays a role in the regulation of behavior, including impulsive behavior. Required for normal proliferation of embryonic cardiac myocytes and normal heart development. Protects cardiomyocytes against apoptosis. Plays a role in the adaptation of pulmonary arteries to chronic hypoxia. Plays a role in vasoconstriction. Required for normal osteoblast function and proliferation, and for maintaining normal bone density. Required for normal proliferation of the interstitial cells of Cajal in the intestine.
Pfam Domain Function
Transmembrane Regions
57-79 91-113 130-151 172-192 217-239 325-345 361-382
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016079|5-hydroxytryptamine receptor 2B (HTR2B)
ATGGCTCTCTCTTACAGAGTGTCTGAACTTCAAAGCACAATTCCTGAGCACATTTTGCAG
AGCACCTTTGTTCACGTTATCTCTTCTAACTGGTCTGGATTACAGACAGAATCAATACCA
GAGGAAATGAAACAGATTGTTGAGGAACAGGGAAATAAACTGCACTGGGCAGCTCTTCTG
ATACTCATGGTGATAATACCCACAATTGGTGGAAATACCCTTGTTATTCTGGCTGTTTCA
CTGGAGAAGAAGCTGCAGTATGCTACTAATTACTTTCTAATGTCCTTGGCGGTGGCTGAT
TTGCTGGTTGGATTGTTTGTGATGCCAATTGCCCTCTTGACAATAATGTTTGAGGCTATG
TGGCCCCTCCCACTTGTTCTATGTCCTGCCTGGTTATTTCTTGACGTTCTCTTTTCAACC
GCATCCATCATGCATCTCTGTGCCATTTCAGTGGATCGTTACATAGCCATCAAAAAGCCA
ATCCAGGCCAATCAATATAACTCACGGGCTACAGCATTCATCAAGATTACAGTGGTGTGG
TTAATTTCAATAGGCATTGCCATTCCAGTCCCTATTAAAGGGATAGAGACTGATGTGGAC
AACCCAAACAATATCACTTGTGTGCTGACAAAGGAACGTTTTGGCGATTTCATGCTCTTT
GGCTCACTGGCTGCCTTCTTCACACCTCTTGCAATTATGATTGTCACCTACTTTCTCACT
ATCCATGCTTTACAGAAGAAGGCTTACTTAGTCAAAAACAAGCCACCTCAACGCCTAACA
TGGTTGACTGTGTCTACAGTTTTCCAAAGGGATGAAACACCTTGCTCGTCACCGGAAAAG
GTGGCAATGCTGGATGGTTCTCGAAAGGACAAGGCTCTGCCCAACTCAGGTGATGAAACA
CTTATGCGAAGAACATCCACAATTGGGAAAAAGTCAGTGCAGACCATTTCCAACGAACAG
AGAGCCTCAAAGGTCCTAGGGATTGTGTTTTTCCTCTTTTTGCTTATGTGGTGTCCCTTC
TTTATTACAAATATAACTTTAGTTTTATGTGATTCCTGTAACCAAACTACTCTCCAAATG
CTCCTGGAGATATTTGTGTGGATAGGCTATGTTTCCTCAGGAGTGAATCCTTTGGTCTAC
ACCCTCTTCAATAAGACATTTCGGGATGCATTTGGCCGATATATCACCTGCAATTACCGG
GCCACAAAGTCAGTAAAAACTCTCAGAAAACGCTCCAGTAAGATCTACTTCCGGAATCCA
ATGGCAGAGAACTCTAAGTTTTTCAAGAAACATGGAATTCGAAATGGGATTAACCCTGCC
ATGTACCAGAGTCCAATGAGGCTCCGAAGTTCAACCATTCAGTCTTCATCAATCATTCTA
CTAGATACGCTTCTCCTCACTGAAAATGAAGGTGACAAAACTGAAGAGCAAGTTAGTTAT
GTATAG
Chromosome Location
2
Locus
2q36.3-q37.1
External Identifiers
ResourceLink
UniProtKB IDP41595
UniProtKB Entry Name5HT2B_HUMAN
GenBank Protein ID475198
GenBank Gene IDX77307
GenAtlas IDHTR2B
HGNC IDHGNC:5294
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00216Eletriptanapproved, investigationalunknownagonistDetails
DB00508Triflupromazineapproved, vet_approvedyesantagonistDetails
DB00805MinaprineapprovedyesantagonistDetails
DB00574Fenfluramineillicit, investigational, withdrawnyesagonistDetails
DB01079Tegaserodinvestigational, withdrawnunknownantagonistDetails
DB01239Chlorprothixeneapproved, investigational, withdrawnyesantagonistDetails
DB05461OPC-28326investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalunknownantagonistDetails
DB00248CabergolineapprovedunknownagonistDetails
DB00413Pramipexoleapproved, investigationalunknownunknownDetails
DB00268Ropiniroleapproved, investigationalunknownagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00247MethysergideapprovedyesantagonistDetails
DB00320DihydroergotamineapprovedunknownagonistDetails
DB01242Clomipramineapproved, vet_approvedyesantagonistDetails
DB01142DoxepinapprovedyesantagonistDetails
DB01454Midomafetamineexperimental, illicit, investigationalunknownagonistDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB01392Yohimbineapproved, vet_approvedunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownbinderDetails
DB06016CariprazineapprovedyesantagonistDetails
DB00696ErgotamineapprovedunknownDetails
DB00353MethylergometrineapprovedunknownDetails
DB04829Lysergic Acid Diethylamideillicit, investigational, withdrawnunknownagonistDetails
DB01049Ergoloid mesylateapprovedunknownantagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB09304SetiptilineapprovedunknownantagonistDetails
DB00477Chlorpromazineapproved, vet_approvedunknownbinderDetails
DB01221Ketamineapproved, vet_approvedunknownantagonistDetails
DB06678Esmirtazapineinvestigationalunknowninverse agonistDetails