Gamma-aminobutyric acid receptor subunit alpha-2

Details

Name
Gamma-aminobutyric acid receptor subunit alpha-2
Synonyms
  • GABA(A) receptor subunit alpha-2
Gene Name
GABRA2
Organism
Human
Amino acid sequence
>lcl|BSEQ0037005|Gamma-aminobutyric acid receptor subunit alpha-2
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
Number of residues
451
Molecular Weight
51325.85
Theoretical pI
9.41
GO Classification
Functions
inhibitory extracellular ligand-gated ion channel activity / chloride channel activity / GABA-A receptor activity / benzodiazepine receptor activity
Processes
ion transmembrane transport / regulation of neurotransmitter levels / response to drug / chloride transmembrane transport / regulation of membrane potential / neurotransmitter transport / gamma-aminobutyric acid signaling pathway / neurological system process / synaptic transmission / transmembrane transport
Components
postsynaptic membrane / neuron projection / axon / plasma membrane / chloride channel complex / GABA-A receptor complex / cell junction / integral component of synaptic vesicle membrane / integral component of plasma membrane
General Function
Inhibitory extracellular ligand-gated ion channel activity
Specific Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions
252-273 279-300 313-334 420-441
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0010268|Gamma-aminobutyric acid receptor subunit alpha-2 (GABRA2)
ATGAAGACAAAATTGAACATCTACAACATGCAGTTCCTGCTTTTTGTTTTCTTGGTGTGG
GACCCTGCCAGGTTGGTGCTGGCTAACATCCAAGAAGATGAGGCTAAAAATAACATTACC
ATCTTTACGAGAATTCTTGACAGACTTCTGGATGGTTACGATAATCGGCTTAGACCAGGA
CTGGGAGACAGTATTACTGAAGTCTTCACTAACATCTACGTGACCAGTTTTGGCCCTGTC
TCAGATACAGATATGGAATATACAATTGATGTTTTCTTTCGACAAAAATGGAAAGATGAA
CGTTTAAAATTTAAAGGTCCTATGAATATCCTTCGACTAAACAATTTAATGGCTAGCAAA
ATCTGGACTCCAGATACCTTTTTTCACAATGGGAAAAAATCAGTAGCTCATAATATGACA
ATGCCAAATAAGTTGCTTCGAATTCAGGATGATGGGACTCTGCTGTATACCATGAGGCTT
ACAGTTCAAGCTGAATGCCCAATGCACTTGGAGGATTTCCCAATGGATGCTCATTCATGT
CCTCTGAAATTTGGCAGCTATGCATATACAACTTCAGAGGTCACTTATATTTGGACTTAC
AATGCATCTGATTCAGTACAGGTTGCTCCTGATGGCTCTAGGTTAAATCAATATGACCTG
CTGGGCCAATCAATCGGAAAGGAGACAATTAAATCCAGTACAGGTGAATATACTGTAATG
ACAGCTCATTTCCACCTGAAAAGAAAAATTGGGTATTTTGTGATTCAAACCTATCTGCCT
TGCATCATGACTGTCATTCTCTCCCAAGTTTCATTCTGGCTTAACAGAGAATCTGTGCCT
GCAAGAACTGTGTTTGGAGTAACAACTGTCCTAACAATGACAACTCTAAGCATCAGTGCT
CGGAATTCTCTCCCCAAAGTGGCTTATGCAACTGCCATGGACTGGTTTATTGCTGTTTGT
TATGCATTTGTGTTCTCTGCCCTAATTGAATTTGCAACTGTTAATTACTTCACCAAAAGA
GGATGGGCTTGGGATGGGAAGAGTGTAGTAAATGACAAGAAAAAAGAAAAGGCTTCCGTT
ATGATACAGAACAACGCTTATGCAGTGGCTGTTGCCAATTATGCCCCGAATCTTTCAAAA
GATCCAGTTCTCTCCACCATCTCCAAGAGTGCAACCACGCCAGAACCCAACAAGAAGCCA
GAAAACAAGCCAGCTGAAGCAAAGAAAACTTTCAACAGTGTTAGCAAAATTGACAGAATG
TCCAGAATAGTTTTTCCAGTTTTGTTTGGTACCTTTAATTTAGTTTACTGGGCTACATAT
TTAAACAGAGAACCTGTATTAGGGGTCAGTCCTTGA
Chromosome Location
4
Locus
4p12
External Identifiers
ResourceLink
UniProtKB IDP47869
UniProtKB Entry NameGBRA2_HUMAN
GenBank Protein ID386422
GenBank Gene IDS62907
GenAtlas IDGABRA2
HGNC IDHGNC:4076
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01544Flunitrazepamapproved, illicityespotentiatorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedyespotentiatorDetails
DB01567Fludiazepamapproved, illicityespotentiatorDetails
DB01558Bromazepamapproved, illicit, investigationalyespotentiatorDetails
DB00371Meprobamateapproved, illicityesagonistDetails
DB00683Midazolamapproved, illicityespotentiatorDetails
DB00690Flurazepamapproved, illicit, investigationalyespotentiatorDetails
DB04903PagocloneinvestigationalunknownDetails
DB05087GanaxoloneinvestigationalunknownDetails
DB00842OxazepamapprovedyespotentiatorDetails
DB00425ZolpidemapprovedunknownagonistDetails
DB00402Eszopicloneapproved, investigationalunknownagonistDetails
DB00231Temazepamapproved, investigationalyespotentiatorDetails
DB01595NitrazepamapprovedyespotentiatorDetails
DB00897Triazolamapproved, investigationalyespotentiatorDetails
DB01198ZopicloneapprovedyespotentiatorDetails
DB01559Clotiazepamapproved, illicityespotentiatorDetails
DB01588Prazepamapproved, illicityespotentiatorDetails
DB01594CinolazepamapprovedyespotentiatorDetails
DB01589Quazepamapproved, illicityespotentiatorDetails
DB01215Estazolamapproved, illicityespotentiatorDetails
DB00801Halazepamapproved, illicit, withdrawnyespotentiatorDetails
DB00546AdinazolamapprovedyespotentiatorDetails
DB01351Amobarbitalapproved, illicityespotentiatorDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedyespotentiatorDetails
DB00241Butalbitalapproved, illicityespotentiatorDetails
DB00306Talbutalapproved, illicityespotentiatorDetails
DB00418Secobarbitalapproved, vet_approvedyespotentiatorDetails
DB00463MetharbitalwithdrawnyespotentiatorDetails
DB00599Thiopentalapproved, vet_approvedyespotentiatorDetails
DB00794Primidoneapproved, vet_approvedyespotentiatorDetails
DB00849MethylphenobarbitalapprovedyespotentiatorDetails
DB01352Aprobarbitalapproved, illicityespotentiatorDetails
DB01353Butethalapproved, illicityespotentiatorDetails
DB01354HeptabarbitalapprovedyespotentiatorDetails
DB01355HexobarbitalapprovedyespotentiatorDetails
DB01483BarbitalillicityespotentiatorDetails
DB01496Barbituric acid derivativeexperimental, illicityespotentiatorDetails
DB01346Quinidine barbiturateapprovedyespotentiatorDetails
DB00898EthanolapprovedunknownDetails
DB09166EtizolamapprovedyesagonistDetails
DB13872Lormetazepamapprovedyespositive allosteric modulatorDetails
DB13994AZD-7325investigationalyespositive allosteric modulatorDetails
DB01189Desfluraneapprovedyespositive allosteric modulatorDetails
DB00659Acamprosateapproved, investigationalyespositive modulatorDetails
DB00404Alprazolamapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00237Butabarbitalapproved, illicityespositive allosteric modulatorDetails
DB00475Chlordiazepoxideapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00349Clobazamapproved, illicityespositive allosteric modulatorDetails
DB01068Clonazepamapproved, illicityespositive allosteric modulatorDetails
DB00628Clorazepateapproved, illicityespositive allosteric modulatorDetails
DB00186Lorazepamapprovedyespositive allosteric modulatorDetails
DB00189Ethchlorvynolapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00228Enfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00231Temazepamapproved, investigationalyespositive allosteric modulatorDetails
DB00241Butalbitalapproved, illicityespositive allosteric modulatorDetails
DB00273Topiramateapprovedyespositive allosteric modulatorDetails
DB00292Etomidateapprovedyespositive allosteric modulatorDetails
DB00306Talbutalapproved, illicityespositive allosteric modulatorDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00371Meprobamateapproved, illicityespositive allosteric modulatorDetails
DB00402Eszopicloneapproved, investigationalyespositive allosteric modulatorDetails
DB00463Metharbitalwithdrawnyespositive allosteric modulatorDetails
DB00753Isofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00794Primidoneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00801Halazepamapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00818Propofolapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00842Oxazepamapprovedyespositive allosteric modulatorDetails
DB00897Triazolamapproved, investigationalyespositive allosteric modulatorDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB01107Methyprylonapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB01159Halothaneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01205Flumazenilapprovedyespositive allosteric modulatorDetails
DB01215Estazolamapproved, illicityespositive allosteric modulatorDetails
DB01236Sevofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01437Glutethimideapproved, illicityespositive allosteric modulatorDetails
DB01588Prazepamapproved, illicityespositive allosteric modulatorDetails
DB01589Quazepamapproved, illicityespositive allosteric modulatorDetails
DB00543AmoxapineapprovedunknownbinderDetails
DB00334Olanzapineapproved, investigationalunknowninhibitorDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownantagonistDetails
DB11582Thiocolchicosideapproved, investigationalyesantagonistDetails
DB09118Stiripentolapprovedyesagonistpositive allosteric modulatorDetails
DB01956Taurineapproved, nutraceuticalyesagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11901Apalutamideapproved, investigationalunknownantagonistDetails
DB06579Adipiploninvestigationalyespartial agonistDetails
DB139835,7,2′-trihydroxy-6,8-dimethoxyflavoneexperimentalunknownligandDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails