Voltage-dependent L-type calcium channel subunit beta-3

Details

Name
Voltage-dependent L-type calcium channel subunit beta-3
Synonyms
  • CAB3
  • CACNLB3
  • Calcium channel voltage-dependent subunit beta 3
Gene Name
CACNB3
Organism
Human
Amino acid sequence
>lcl|BSEQ0004631|Voltage-dependent L-type calcium channel subunit beta-3
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
HHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWP
KDSY
Number of residues
484
Molecular Weight
54531.425
Theoretical pI
6.31
GO Classification
Functions
voltage-gated calcium channel activity / high voltage-gated calcium channel activity
Processes
transport / T cell receptor signaling pathway / calcium ion transport / regulation of voltage-gated calcium channel activity / synaptic transmission / axon guidance / neuromuscular junction development / membrane depolarization
Components
membrane / voltage-gated calcium channel complex / cytosol / apical plasma membrane
General Function
Voltage-gated calcium channel activity
Specific Function
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0019274|Voltage-dependent L-type calcium channel subunit beta-3 (CACNB3)
ATGTATGACGACTCCTACGTGCCCGGGTTTGAGGACTCGGAGGCGGGTTCAGCCGACTCC
TACACCAGCCGCCCATCTCTGGACTCAGACGTCTCCCTGGAGGAGGACCGGGAGAGTGCC
CGGCGTGAAGTAGAGAGCCAGGCTCAGCAGCAGCTCGAAAGGGCCAAGCACAAACCTGTG
GCATTTGCGGTGAGGACCAATGTCAGCTACTGTGGCGTACTGGATGAGGAGTGCCCAGTC
CAGGGCTCTGGAGTCAACTTTGAGGCCAAAGATTTTCTGCACATTAAAGAGAAGTACAGC
AATGACTGGTGGATCGGGCGGCTAGTGAAAGAGGGCGGGGACATCGCCTTCATCCCCAGC
CCCCAGCGCCTGGAGAGCATCCGGCTCAAACAGGAGCAGAAGGCCAGGAGATCTGGGAAC
CCTTCCAGCCTGAGTGACATTGGCAACCGACGCTCCCCTCCGCCATCTCTAGCCAAGCAG
AAGCAAAAGCAGGCGGAACATGTTCCCCCATATGACGTGGTGCCCTCCATGCGGCCTGTG
GTGCTGGTGGGACCCTCTCTGAAAGGTTATGAGGTCACAGACATGATGCAGAAGGCTCTC
TTCGACTTCCTCAAACACAGATTTGATGGCAGGATCTCCATCACCCGAGTCACAGCCGAC
CTCTCCCTGGCAAAGCGATCTGTGCTCAACAATCCGGGCAAGAGGACCATCATTGAGCGC
TCCTCTGCCCGCTCCAGCATTGCGGAAGTGCAGAGTGAGATCGAGCGCATATTTGAGCTG
GCCAAATCCCTGCAGCTAGTAGTGTTGGACGCTGACACCATCAACCACCCAGCACAGCTG
GCCAAGACCTCGCTGGCCCCCATCATCGTCTTTGTCAAAGTGTCCTCACCAAAGGTACTC
CAGCGTCTCATTCGCTCCCGGGGGAAGTCACAGATGAAGCACCTGACCGTACAGATGATG
GCATATGATAAGCTGGTTCAGTGCCCACCGGAGTCATTTGATGTGATTCTGGATGAGAAC
CAGCTGGAGGATGCCTGTGAGCACCTGGCTGAGTACCTGGAGGTTTACTGGCGGGCCACG
CACCACCCAGCCCCTGGCCCCGGACTTCTGGGTCCTCCCAGTGCCATCCCCGGACTTCAG
AACCAGCAGCTGCTGGGGGAGCGTGGCGAGGAGCACTCCCCCCTTGAGCGGGACAGCTTG
ATGCCCTCTGATGAGGCCAGCGAGAGCTCCCGCCAAGCCTGGACAGGATCTTCACAGCGT
AGCTCCCGCCACCTGGAGGAGGACTATGCAGATGCCTACCAGGACCTGTACCAGCCTCAC
CGCCAACACACCTCGGGGCTGCCTAGTGCTAACGGGCATGACCCCCAAGACCGGCTTCTA
GCCCAGGACTCAGAGCACAACCACAGTGACCGGAACTGGCAGCGCAACCGGCCTTGGCCC
AAGGATAGCTACTGA
Chromosome Location
12
Locus
12q13
External Identifiers
ResourceLink
UniProtKB IDP54284
UniProtKB Entry NameCACB3_HUMAN
GenBank Protein ID435135
GenBank Gene IDX76555
GenAtlas IDCACNB3
HGNC IDHGNC:1403
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00661VerapamilapprovedyesinhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB00393Nimodipineapproved, investigationalyesinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium CitrateapprovedunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedyesinhibitorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09236Lacidipineapproved, investigationalyesantagonistDetails
DB09231Benidipineapproved, investigationalyesantagonistDetails
DB09232Cilnidipineapproved, investigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB00825MentholapprovedyesantagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails