Aquaporin Z
Details
- Name
- Aquaporin Z
- Synonyms
- Bacterial nodulin-like intrinsic protein
- bniP
- Gene Name
- aqpZ
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0017235|Aquaporin Z MFRKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGG HFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNG YGEHSPGGYSMLSALVVELVLSAGFLLVIHGATDKFAPAGFAPIAIGLALTLIHLISIPV TNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLLEKRD
- Number of residues
- 231
- Molecular Weight
- 23702.58
- Theoretical pI
- 7.63
- GO Classification
- Functionsidentical protein binding / water channel activityProcessescellular water homeostasis / response to osmotic stress / water transportComponentsintegral component of membrane / integral component of plasma membrane / plasma membrane
- General Function
- Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.
- Specific Function
- Identical protein binding
- Pfam Domain Function
- MIP (PF00230)
- Transmembrane Regions
- 9-29 34-54 82-102 131-151 156-176 202-222
- Cellular Location
- Cell inner membrane
- Gene sequence
>lcl|BSEQ0017236|Aquaporin Z (aqpZ) ATGTTCAGAAAATTAGCAGCTGAATGTTTTGGTACTTTCTGGCTTGTTTTTGGTGGCTGT GGTAGTGCTGTACTGGCCGCAGGCTTCCCGGAATTAGGCATTGGTTTTGCCGGCGTGGCG TTGGCGTTCGGTCTGACCGTTCTGACGATGGCCTTTGCTGTTGGTCATATTTCTGGTGGT CATTTTAACCCGGCGGTCACTATTGGTTTATGGGCTGGCGGACGTTTTCCGGCAAAAGAA GTCGTTGGCTACGTAATTGCCCAGGTTGTCGGCGGTATTGTTGCAGCGGCGCTGCTGTAT TTAATTGCCAGTGGTAAAACGGGTTTTGACGCGGCAGCCAGCGGTTTTGCTTCTAACGGT TATGGCGAGCATTCACCAGGCGGTTATTCCATGCTTTCCGCGCTGGTAGTTGAACTGGTA TTGAGTGCAGGTTTCCTGTTGGTGATCCACGGCGCAACCGACAAATTCGCGCCGGCAGGT TTTGCGCCGATCGCTATTGGTCTGGCCTTAACCCTGATTCACTTAATTAGTATTCCGGTG ACTAACACTTCTGTTAACCCGGCGCGCAGCACCGCGGTTGCTATCTTCCAGGGCGGCTGG GCATTAGAACAACTGTGGTTCTTCTGGGTGGTGCCAATTGTCGGCGGCATTATCGGTGGT CTGATTTACCGGACCCTGCTGGAAAAGCGTGATTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P60844 UniProtKB Entry Name AQPZ_ECOLI GenBank Protein ID 1051283 GenBank Gene ID U38664 - General References
- Calamita G, Bishai WR, Preston GM, Guggino WB, Agre P: Molecular cloning and characterization of AqpZ, a water channel from Escherichia coli. J Biol Chem. 1995 Dec 8;270(49):29063-6. [Article]
- Fushimi K, Bai L, Marumo F, Sasaki S: Isolation of a gene encoding nodulin-like intrinsic protein of Escherichia coli. Biochem Mol Biol Int. 1997 Apr;41(5):995-1003. [Article]
- Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.: A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. DNA Res. 1996 Jun 30;3(3):137-55. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Delamarche C, Thomas D, Rolland JP, Froger A, Gouranton J, Svelto M, Agre P, Calamita G: Visualization of AqpZ-mediated water permeability in Escherichia coli by cryoelectron microscopy. J Bacteriol. 1999 Jul;181(14):4193-7. [Article]
- Borgnia MJ, Kozono D, Calamita G, Maloney PC, Agre P: Functional reconstitution and characterization of AqpZ, the E. coli water channel protein. J Mol Biol. 1999 Sep 3;291(5):1169-79. [Article]
- Pohl P, Saparov SM, Borgnia MJ, Agre P: Highly selective water channel activity measured by voltage clamp: analysis of planar lipid bilayers reconstituted with purified AqpZ. Proc Natl Acad Sci U S A. 2001 Aug 14;98(17):9624-9. Epub 2001 Aug 7. [Article]
- Ringler P, Borgnia MJ, Stahlberg H, Maloney PC, Agre P, Engel A: Structure of the water channel AqpZ from Escherichia coli revealed by electron crystallography. J Mol Biol. 1999 Sep 3;291(5):1181-90. [Article]
- Scheuring S, Ringler P, Borgnia M, Stahlberg H, Muller DJ, Agre P, Engel A: High resolution AFM topographs of the Escherichia coli water channel aquaporin Z. EMBO J. 1999 Sep 15;18(18):4981-7. [Article]
- Daley DO, Rapp M, Granseth E, Melen K, Drew D, von Heijne G: Global topology analysis of the Escherichia coli inner membrane proteome. Science. 2005 May 27;308(5726):1321-3. [Article]
- Savage DF, Egea PF, Robles-Colmenares Y, O'Connell JD 3rd, Stroud RM: Architecture and selectivity in aquaporins: 2.5 a X-ray structure of aquaporin Z. PLoS Biol. 2003 Dec;1(3):E72. Epub 2003 Dec 22. [Article]
- Calamita G: The Escherichia coli aquaporin-Z water channel. Mol Microbiol. 2000 Jul;37(2):254-62. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB07349 (1S)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PENTANOYLOXY)METHYL]ETHYL OCTANOATE experimental unknown Details DB03152 B-2-Octylglucoside experimental unknown Details DB07923 octyl alpha-L-altropyranoside experimental unknown Details DB07924 octyl beta-D-galactopyranoside experimental unknown Details