6,7-dimethyl-8-ribityllumazine synthase
Details
- Name
- 6,7-dimethyl-8-ribityllumazine synthase
- Synonyms
- 2.5.1.78
- DMRL synthase
- Gene Name
- ribH
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Amino acid sequence
>lcl|BSEQ0051159|6,7-dimethyl-8-ribityllumazine synthase MKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAI EIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTN TEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
- Number of residues
- 160
- Molecular Weight
- 16370.415
- Theoretical pI
- Not Available
- GO Classification
- Functions6,7-dimethyl-8-ribityllumazine synthase activity / transferase activityProcessesgrowth / riboflavin biosynthetic processComponentscytosol / riboflavin synthase complex
- General Function
- Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin.
- Specific Function
- 6,7-dimethyl-8-ribityllumazine synthase activity
- Pfam Domain Function
- DMRL_synthase (PF00885)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051160|6,7-dimethyl-8-ribityllumazine synthase (ribH) GTGAAGGGTGGCGCCGGGGTGCCGGATCTGCCGTCGCTGGATGCGTCTGGTGTGCGGCTG GCGATTGTCGCCAGCAGCTGGCACGGAAAGATCTGCGACGCGCTGTTGGACGGCGCCCGC AAGGTGGCCGCCGGGTGTGGCCTCGATGACCCGACTGTGGTTCGGGTGCTCGGCGCGATC GAGATTCCGGTGGTGGCGCAGGAATTGGCCCGCAATCATGATGCCGTCGTCGCACTTGGC GTCGTGATCCGCGGTCAGACACCACATTTCGACTACGTGTGCGATGCGGTAACCCAGGGA CTGACCCGGGTATCGCTGGATTCCTCGACGCCGATCGCCAACGGCGTGCTGACCACCAAC ACCGAGGAGCAGGCGCTGGATCGGGCGGGGCTACCGACGTCGGCCGAGGACAAGGGCGCC CAGGCGACTGTGGCAGCCCTGGCCACCGCGTTGACCCTGCGCGAGCTGCGCGCTCACTCG TGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WHE9 UniProtKB Entry Name RISB_MYCTU - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Cushman M, Sambaiah T, Jin G, Illarionov B, Fischer M, Bacher A: Design, synthesis, and evaluation of 9-D-ribitylamino-1,3,7,9-tetrahydro-2,6,8-purinetriones bearing alkyl phosphate and alpha,alpha-difluorophosphonate substituents as inhibitors of tiboflavin synthase and lumazine synthase. J Org Chem. 2004 Feb 6;69(3):601-12. [Article]
- Rison SC, Mattow J, Jungblut PR, Stoker NG: Experimental determination of translational starts using peptide mass mapping and tandem mass spectrometry within the proteome of Mycobacterium tuberculosis. Microbiology. 2007 Feb;153(Pt 2):521-8. [Article]
- Raman K, Yeturu K, Chandra N: targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis. BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Morgunova E, Meining W, Illarionov B, Haase I, Jin G, Bacher A, Cushman M, Fischer M, Ladenstein R: Crystal structure of lumazine synthase from Mycobacterium tuberculosis as a target for rational drug design: binding mode of a new class of purinetrione inhibitors. Biochemistry. 2005 Mar 1;44(8):2746-58. [Article]
- Morgunova E, Illarionov B, Sambaiah T, Haase I, Bacher A, Cushman M, Fischer M, Ladenstein R: Structural and thermodynamic insights into the binding mode of five novel inhibitors of lumazine synthase from Mycobacterium tuberculosis. FEBS J. 2006 Oct;273(20):4790-804. Epub 2006 Sep 19. [Article]
- Zhang Y, Illarionov B, Morgunova E, Jin G, Bacher A, Fischer M, Ladenstein R, Cushman M: A new series of N-[2,4-dioxo-6-d-ribitylamino-1,2,3,4-tetrahydropyrimidin-5-yl]oxalamic acid derivatives as inhibitors of lumazine synthase and riboflavin synthase: design, synthesis, biochemical evaluation, crystallography, and mechanistic implications. J Org Chem. 2008 Apr 4;73(7):2715-24. doi: 10.1021/jo702631a. Epub 2008 Mar 11. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01692 Dithioerythritol experimental unknown Details DB02135 1-deoxy-1-{2,6,8-trioxo-7-[4-(phosphonooxy)butyl]-1,2,3,6,7,8-hexahydro-9H-purin-9-yl}-D-arabinitol experimental unknown Details DB02184 D-1,4-dithiothreitol experimental unknown Details DB02290 3-{2,6,8-trioxo-9-[(2S,3S,4R)-2,3,4,5-tetrahydroxypentyl]-1,2,3,6,8,9-hexahydro-7H-purin-7-Yl}propyl dihydrogen phosphate experimental unknown Details DB02693 (4S,5S)-1,2-dithiane-4,5-diol experimental unknown Details DB02711 4-{2,6,8-Trioxo-9-[(2S,3R,4R)-2,3,4,5-Tetrahydroxypentyl]-1,2,3,6,8,9-Hexahydro-7h-Purin-7-Yl}Butyl Dihydrogen Phosphate experimental unknown Details DB03022 3-[2,6,8-Trioxo-9-[(2R,3S,4R)-2,3,4,5-tetrahydroxypentyl]-3H-purin-7-yl]propyl dihydrogen phosphate experimental unknown Details DB03812 3-{2,6,8-trioxo-9-[(2S,3R,4R)-2,3,4,5-tetrahydroxypentyl]-1,2,3,6,8,9-hexahydro-7H-purin-7-Yl}propyl dihydrogen phosphate experimental unknown Details DB03973 3-[2,6,8-Trioxo-9-[(2R,3R,4R)-2,3,4,5-tetrahydroxypentyl]-3H-purin-7-yl]propyl dihydrogen phosphate experimental unknown Details DB08016 4-(6-CHLORO-2,4-DIOXO-1,2,3,4-TETRAHYDROPYRIMIDIN-5-YL) BUTYL PHOSPHATE experimental unknown Details