Cryptochrome DASH
Details
- Name
- Cryptochrome DASH
- Synonyms
- phr
- phrB
- Gene Name
- cry
- Organism
- Synechocystis sp. (strain PCC 6803 / Kazusa)
- Amino acid sequence
>lcl|BSEQ0005804|Cryptochrome DASH MKHVPPTVLVWFRNDLRLHDHEPLHRALKSGLAITAVYCYDPRQFAQTHQGFAKTGPWRS NFLQQSVQNLAESLQKVGNKLLVTTGLPEQVIPQIAKQINAKTIYYHREVTQEELDVERN LVKQLTILGIEAKGYWGSTLCHPEDLPFSIQDLPDLFTKFRKDIEKKKISIRPCFFAPSQ LLPSPNIKLELTAPPPEFFPQINFDHRSVLAFQGGETAGLARLQDYFWHGDRLKDYKETR NGMVGADYSSKFSPWLALGCLSPRFIYQEVKRYEQERVSNDSTHWLIFELLWRDFFRFVA QKYGNKLFNRGGLLNKNFPWQEDQVRFELWRSGQTGYPLVDANMRELNLTGFMSNRGRQN VASFLCKNLGIDWRWGAEWFESCLIDYDVCSNWGNWNYTAGIGNDARDFRYFNIPKQSQQ YDPQGTYLRHWLPELKNLPGDKIHQPWLLSATEQKQWGVQLGVDYPRPCVNFHQSVEARR KIEQMGVIA
- Number of residues
- 489
- Molecular Weight
- 57039.58
- Theoretical pI
- 8.8
- GO Classification
- FunctionsDNA binding / DNA photolyase activityProcessesDNA repair / protein-chromophore linkage / regulation of transcription, DNA-templated / transcription, DNA-templated
- General Function
- Dna photolyase activity
- Specific Function
- May have a photoreceptor function. Binds DNA; represses transcription of at least 8 genes, including slr0364 and slr1866. Does not encode a DNA photolyase function. Its disruption does not affect circadian rhythm.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P77967 UniProtKB Entry Name CRYD_SYNY3 - General References
- Kaneko T, Sato S, Kotani H, Tanaka A, Asamizu E, Nakamura Y, Miyajima N, Hirosawa M, Sugiura M, Sasamoto S, Kimura T, Hosouchi T, Matsuno A, Muraki A, Nakazaki N, Naruo K, Okumura S, Shimpo S, Takeuchi C, Wada T, Watanabe A, Yamada M, Yasuda M, Tabata S: Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp. strain PCC6803. II. Sequence determination of the entire genome and assignment of potential protein-coding regions. DNA Res. 1996 Jun 30;3(3):109-36. [Article]
- Hitomi K, Okamoto K, Daiyasu H, Miyashita H, Iwai S, Toh H, Ishiura M, Todo T: Bacterial cryptochrome and photolyase: characterization of two photolyase-like genes of Synechocystis sp. PCC6803. Nucleic Acids Res. 2000 Jun 15;28(12):2353-62. [Article]
- Worthington EN, Kavakli IH, Berrocal-Tito G, Bondo BE, Sancar A: Purification and characterization of three members of the photolyase/cryptochrome family blue-light photoreceptors from Vibrio cholerae. J Biol Chem. 2003 Oct 3;278(40):39143-54. Epub 2003 Jul 22. [Article]
- Brudler R, Hitomi K, Daiyasu H, Toh H, Kucho K, Ishiura M, Kanehisa M, Roberts VA, Todo T, Tainer JA, Getzoff ED: Identification of a new cryptochrome class. Structure, function, and evolution. Mol Cell. 2003 Jan;11(1):59-67. [Article]