Orange carotenoid-binding protein
Details
- Name
- Orange carotenoid-binding protein
- Synonyms
- OCP
- Gene Name
- Not Available
- Organism
- Arthrospira maxima
- Amino acid sequence
>lcl|BSEQ0011995|Orange carotenoid-binding protein MPFTIDTARSIFPETLAADVVPATIARFKQLSAEDQLALIWFAYLEMGKTITIAAPGAAN MQFAENTLQEIRQMTPLQQTQAMCDLANRTDTPICRTYASWSPNIKLGFWYELGRFMDQG LVAPIPEGYKLSANANAILVTIQGIDPGQQITVLRNCVVDMGFDTSKLGSYQRVAEPVVP PQEMSQRTKVQIEGVTNSTVLQYMDNLNANDFDNLISLFAEDGALQPPFQKPIVGKENTL RFFREECQNLKLIPERGVSEPTEDGYTQIKVTGKVQTPWFGGNVGMNIAWRFLLNPENKV FFVAIDLLASPKELLNL
- Number of residues
- 317
- Molecular Weight
- 35347.29
- Theoretical pI
- 4.54
- GO Classification
- Functionschloride ion binding / photoreceptor activityProcesseslight absorption / protein-chromophore linkage / transportComponentsphycobilisome
- General Function
- Photoreceptor activity
- Specific Function
- Acts as a blue-light photoreceptor and photo-protectant. Essential for inhibiting damaged induced by excess blue-green light via a process known as non-photochemical quenching (NPQ). Binding carotenoids improves OCP's intrinsic photoprotectant activity by broadening its absorption spectrum and facilitating the dissipation of absorbed energy (PubMed:15751975). In the dark or dim light the stable inactive form (OCP-O) is orange, upon illumination with blue-green light it converts to a metastable active red form (OCP-R), inducing energy dissipation, quenching cellular fluorescence via NPQ (By similarity).
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Cellular thylakoid membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P83689 UniProtKB Entry Name OCP_ARTMA - General References
- Wu YP, Krogmann DW: The orange carotenoid protein of Synechocystis PCC 6803. Biochim Biophys Acta. 1997 Nov 10;1322(1):1-7. [Article]
- Kerfeld CA: Water-soluble carotenoid proteins of cyanobacteria. Arch Biochem Biophys. 2004 Oct 1;430(1):2-9. [Article]
- Polivka T, Kerfeld CA, Pascher T, Sundstrom V: Spectroscopic properties of the carotenoid 3'-hydroxyechinenone in the orange carotenoid protein from the cyanobacterium Arthrospira maxima. Biochemistry. 2005 Mar 15;44(10):3994-4003. [Article]
- Kerfeld CA, Wu YP, Chan C, Krogmann DW, Yeates TO: Crystals of the carotenoid protein from Arthrospira maxima containing uniformly oriented pigment molecules. Acta Crystallogr D Biol Crystallogr. 1997 Nov 1;53(Pt 6):720-3. [Article]
- Kerfeld CA, Sawaya MR, Brahmandam V, Cascio D, Ho KK, Trevithick-Sutton CC, Krogmann DW, Yeates TO: The crystal structure of a cyanobacterial water-soluble carotenoid binding protein. Structure. 2003 Jan;11(1):55-65. [Article]