ATP synthase subunit c

Details

Name
ATP synthase subunit c
Synonyms
  • ATP synthase F(0) sector subunit c
  • F-ATPase subunit c
  • F-type ATPase subunit c
  • Lipid-binding protein
Gene Name
atpE
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Amino acid sequence
>lcl|BSEQ0051282|ATP synthase subunit c
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV
EAAYFINLAFMALFVFATPVK
Number of residues
81
Molecular Weight
8055.41
Theoretical pI
Not Available
GO Classification
Functions
lipid binding / proton-transporting ATP synthase activity, rotational mechanism
Processes
ATP synthesis coupled proton transport / growth / ATP hydrolysis coupled proton transport
Components
plasma membrane / integral component of membrane / proton-transporting ATP synthase complex, coupling factor F(o)
General Function
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Specific Function
Lipid binding
Pfam Domain Function
Transmembrane Regions
5-25 57-77
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0051283|ATP synthase subunit c (atpE)
ATGGACCCCACTATCGCTGCCGGCGCCCTCATCGGCGGTGGACTGATCATGGCCGGTGGC
GCCATCGGCGCCGGTATCGGTGACGGTGTCGCCGGTAACGCGCTTATCTCCGGTGTCGCC
CGGCAACCCGAGGCGCAAGGGCGGCTGTTCACACCGTTCTTCATCACCGTCGGTTTGGTT
GAGGCGGCATACTTCATCAACCTGGCGTTTATGGCGCTGTTCGTCTTCGCTACACCCGTC
AAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP9WPS1
UniProtKB Entry NameATPL_MYCTU
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08903BedaquilineapprovedyesinhibitorDetails