Sodium-dependent dopamine transporter

Details

Name
Sodium-dependent dopamine transporter
Synonyms
  • DA transporter
  • DAT1
  • Solute carrier family 6 member 3
Gene Name
SLC6A3
Organism
Human
Amino acid sequence
>lcl|BSEQ0010450|Sodium-dependent dopamine transporter
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Number of residues
620
Molecular Weight
68494.255
Theoretical pI
6.92
GO Classification
Functions
dopamine / dopamine binding / monoamine transmembrane transporter activity / dopamine transmembrane transporter activity
Processes
monoamine transport / adenohypophysis development / neurotransmitter biosynthetic process / ammonium transmembrane transport / synaptic transmission / dopamine biosynthetic process / response to cocaine / dopamine catabolic process / lactation / dopamine uptake involved in synaptic transmission / prepulse inhibition / positive regulation of multicellular organism growth / sensory perception of smell / transmembrane transport / regulation of dopamine metabolic process / locomotory behavior / dopamine transport
Components
cytoplasm / plasma membrane / cell surface / neuronal cell body / integral component of membrane / axon / integral component of plasma membrane / flotillin complex
General Function
Monoamine transmembrane transporter activity
Specific Function
Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
Pfam Domain Function
Transmembrane Regions
69-89 96-116 140-160 238-256 265-282 318-335 347-368 401-420 447-465 481-501 522-541 560-578
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010451|Sodium-dependent dopamine transporter (SLC6A3)
ATGAGTAAGAGCAAATGCTCCGTGGGACTCATGTCTTCCGTGGTGGCCCCGGCTAAGGAG
CCCAATGCCGTGGGCCCGAAGGAGGTGGAGCTCATCCTTGTCAAGGAGCAGAACGGAGTG
CAGCTCACCAGCTCCACCCTCACCAACCCGCGGCAGAGCCCCGTGGAGGCCCAGGATCGG
GAGACCTGGGGCAAGAAGATCGACTTTCTCCTGTCCGTCATTGGCTTTGCTGTGGACCTG
GCCAACGTCTGGCGGTTCCCCTACCTGTGCTACAAAAATGGTGGCGGTGCCTTCCTGGTC
CCCTACCTGCTCTTCATGGTCATTGCTGGGATGCCACTTTTCTACATGGAGCTGGCCCTC
GGCCAGTTCAACAGGGAAGGGGCCGCTGGTGTCTGGAAGATCTGCCCCATACTGAAAGGT
GTGGGCTTCACGGTCATCCTCATCTCACTGTATGTCGGCTTCTTCTACAACGTCATCATC
GCCTGGGCGCTGCACTATCTCTTCTCCTCCTTCACCACGGAGCTCCCCTGGATCCACTGC
AACAACTCCTGGAACAGCCCCAACTGCTCGGATGCCCATCCTGGTGACTCCAGTGGAGAC
AGCTCGGGCCTCAACGACACTTTTGGGACCACACCTGCTGCCGAGTACTTTGAACGTGGC
GTGCTGCACCTCCACCAGAGCCATGGCATCGACGACCTGGGGCCTCCGCGGTGGCAGCTC
ACAGCCTGCCTGGTGCTGGTCATCGTGCTGCTCTACTTCAGCCTCTGGAAGGGCGTGAAG
ACCTCAGGGAAGGTGGTATGGATCACAGCCACCATGCCATACGTGGTCCTCACTGCCCTG
CTCCTGCGTGGGGTCACCCTCCCTGGAGCCATAGACGGCATCAGAGCATACCTGAGCGTT
GACTTCTACCGGCTCTGCGAGGCGTCTGTTTGGATTGACGCGGCCACCCAGGTGTGCTTC
TCCCTGGGCGTGGGGTTCGGGGTGCTGATCGCCTTCTCCAGCTACAACAAGTTCACCAAC
AACTGCTACAGGGACGCGATTGTCACCACCTCCATCAACTCCCTGACGAGCTTCTCCTCC
GGCTTCGTCGTCTTCTCCTTCCTGGGGTACATGGCACAGAAGCACAGTGTGCCCATCGGG
GACGTGGCCAAGGACGGGCCAGGGCTGATCTTCATCATCTACCCGGAAGCCATCGCCACG
CTCCCTCTGTCCTCAGCCTGGGCCGTGGTCTTCTTCATCATGCTGCTCACCCTGGGTATC
GACAGCGCCATGGGTGGTATGGAGTCAGTGATCACCGGGCTCATCGATGAGTTCCAGCTG
CTGCACAGACACCGTGAGCTCTTCACGCTCTTCATCGTCCTGGCGACCTTCCTCCTGTCC
CTGTTCTGCGTCACCAACGGTGGCATCTACGTCTTCACGCTCCTGGACCATTTTGCAGCC
GGCACGTCCATCCTCTTTGGAGTGCTCATCGAAGCCATCGGAGTGGCCTGGTTCTATGGT
GTTGGGCAGTTCAGCGACGACATCCAGCAGATGACCGGGCAGCGGCCCAGCCTGTACTGG
CGGCTGTGCTGGAAGCTGGTCAGCCCCTGCTTTCTCCTGTTCGTGGTCGTGGTCAGCATT
GTGACCTTCAGACCCCCCCACTACGGAGCCTACATCTTCCCCGACTGGGCCAACGCGCTG
GGCTGGGTCATCGCCACATCCTCCATGGCCATGGTGCCCATCTATGCGGCCTACAAGTTC
TGCAGCCTGCCTGGGTCCTTTCGAGAGAAACTGGCCTACGCCATTGCACCCGAGAAGGAC
CGTGAGCTGGTGGACAGAGGGGAGGTGCGCCAGTTCACGCTCCGCCACTGGCTCAAGGTG
TAG
Chromosome Location
5
Locus
5p15.3
External Identifiers
ResourceLink
UniProtKB IDQ01959
UniProtKB Entry NameSC6A3_HUMAN
GenBank Protein ID553260
GenBank Gene IDM96670
GenAtlas IDSLC6A3
HGNC IDHGNC:11049
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00422Methylphenidateapproved, investigationalyesinhibitorDetails
DB00745Modafinilapproved, investigationalyesinhibitorDetails
DB01156BupropionapprovedyesinhibitorDetails
DB00191Phentermineapproved, illicityesinhibitorDetails
DB00476DuloxetineapprovedunknowninhibitorDetails
DB00579Mazindolapproved, investigationalyesinhibitorDetails
DB00721Procaineapproved, investigational, vet_approvedyesinhibitorDetails
DB00830Phenmetrazineapproved, illicityesinhibitorDetails
DB00907Cocaineapproved, illicityesinhibitorDetails
DB00937Diethylpropionapproved, illicityesinhibitorDetails
DB01161ChloroprocaineapprovedunknowninhibitorDetails
DB00182Amphetamineapproved, illicit, investigationalyesnegative modulatorDetails
DB00245BenzatropineapprovedyesinhibitorDetails
DB01463Fencamfamineapproved, illicit, withdrawnyesinhibitorDetails
DB04947AltropaneinvestigationalunknownDetails
DB01576Dextroamphetamineapproved, illicityesnegative modulatorDetails
DB12305DasotralineinvestigationalunknownDetails
DB06156TesofensineinvestigationalunknownDetails
DB06333TrodusquemineinvestigationalunknownDetails
DB01255Lisdexamfetamineapproved, investigationalyesinhibitorDetails
DB01149Nefazodoneapproved, withdrawnunknowninhibitorDetails
DB04821NomifensinewithdrawnunknownDetails
DB01104SertralineapprovedunknowninhibitorDetails
DB01146Diphenylpyralineapproved, investigationalunknowninhibitorDetails
DB01175Escitalopramapproved, investigationalunknowninhibitorDetails
DB00726TrimipramineapprovedunknowninhibitorDetails
DB01114ChlorphenamineapprovedunknowninhibitorDetails
DB01105Sibutramineapproved, illicit, investigational, withdrawnyesinhibitorDetails
DB00285VenlafaxineapprovedunknowninhibitorDetails
DB00988DopamineapprovedyesinducerDetails
DB00865Benzphetamineapproved, illicitunknowninhibitorDetails
DB06701Dexmethylphenidateapproved, investigationalyesinhibitorDetails
DB01454Midomafetamineexperimental, illicit, investigationalunknownnegative modulatorDetails
DB00852PseudoephedrineapprovedyesinhibitorDetails
DB014724-Methoxyamphetamineexperimental, illicityesinhibitorDetails
DB01577Methamphetamineapproved, illicityesnegative modulatorDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesnegative modulatorDetails
DB01442MMDAexperimental, illicityesnegative modulatorDetails
DB01454Midomafetamineexperimental, illicit, investigationalunknownDetails
DB08824Ioflupane I-123approvednoDetails
DB00215CitalopramapprovedunknownsubstrateinhibitorDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB00458ImipramineapprovedunknownDetails
DB00454PethidineapprovedunknownDetails
DB00289AtomoxetineapprovedunknownbinderDetails
DB00543AmoxapineapprovedunknownbinderDetails
DB06148Mianserinapproved, investigationalunknownbinderDetails
DB06413Armodafinilapproved, investigationalyesantagonistinhibitorDetails
DB03701VanoxerineinvestigationalunknownDetails
DB09194EtoperidonewithdrawnunknowninhibitorDetails