Voltage-dependent L-type calcium channel subunit beta-1

Details

Name
Voltage-dependent L-type calcium channel subunit beta-1
Synonyms
  • CAB1
  • CACNLB1
  • Calcium channel voltage-dependent subunit beta 1
Gene Name
CACNB1
Organism
Human
Amino acid sequence
>lcl|BSEQ0000603|Voltage-dependent L-type calcium channel subunit beta-1
MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LGSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGT
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Number of residues
598
Molecular Weight
65712.995
Theoretical pI
6.75
GO Classification
Functions
voltage-gated calcium channel activity / high voltage-gated calcium channel activity
Processes
transport / synaptic transmission / protein targeting to membrane / axon guidance / neuromuscular junction development / regulation of voltage-gated calcium channel activity
Components
voltage-gated calcium channel complex / T-tubule / sarcoplasmic reticulum
General Function
Voltage-gated calcium channel activity
Specific Function
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010071|Voltage-dependent L-type calcium channel subunit beta-1 (CACNB1)
ATGGTCCAGAAGACCAGCATGTCCCGGGGCCCTTACCCACCCTCCCAGGAGATCCCCATG
GAGGTCTTCGACCCCAGCCCGCAGGGCAAATACAGCAAGAGGAAAGGGCGATTCAAACGG
TCAGATGGGAGCACGTCCTCGGATACCACATCCAACAGCTTTGTCCGCCAGGGCTCAGCG
GAGTCCTACACCAGCCGTCCATCAGACTCTGATGTATCTCTGGAGGAGGACCGGGAAGCC
TTAAGGAAGGAAGCAGAGCGCCAGGCATTAGCGCAGCTCGAGAAGGCCAAGACCAAGCCA
GTGGCATTTGCTGTGCGGACAAATGTTGGCTACAATCCGTCTCCAGGGGATGAGGTGCCT
GTGCAGGGAGTGGCCATCACCTTCGAGCCCAAAGACTTCCTGCACATCAAGGAGAAATAC
AATAATGACTGGTGGATCGGGCGGCTGGTGAAGGAGGGCTGTGAGGTTGGCTTCATTCCC
AGCCCCGTCAAACTGGACAGCCTTCGCCTGCTGCAGGAACAGAAGCTGCGCCAGAACCGC
CTCGGCTCCAGCAAATCAGGCGATAACTCCAGTTCCAGTCTGGGAGATGTGGTGACTGGC
ACCCGCCGCCCCACACCCCCTGCCAGTGCCAAACAGAAGCAGAAGTCGACAGAGCATGTG
CCCCCCTATGACGTGGTGCCTTCCATGAGGCCCATCATCCTGGTGGGACCGTCGCTCAAG
GGCTACGAGGTTACAGACATGATGCAGAAAGCTTTATTTGACTTCTTGAAGCATCGGTTT
GATGGCAGGATCTCCATCACTCGTGTGACGGCAGATATTTCCCTGGCTAAGCGCTCAGTT
CTCAACAACCCCAGCAAACACATCATCATTGAGCGCTCCAACACACGCTCCAGCCTGGCT
GAGGTGCAGAGTGAAATCGAGCGAATCTTCGAGCTGGCCCGGACCCTTCAGTTGGTCGCT
CTGGATGCTGACACCATCAATCACCCAGCCCAGCTGTCCAAGACCTCGCTGGCCCCCATC
ATTGTTTACATCAAGATCACCTCTCCCAAGGTACTTCAAAGGCTCATCAAGTCCCGAGGA
AAGTCTCAGTCCAAACACCTCAATGTCCAAATAGCGGCCTCGGAAAAGCTGGCACAGTGC
CCCCCTGAAATGTTTGACATCATCCTGGATGAGAACCAATTGGAGGATGCCTGCGAGCAT
CTGGCGGAGTACTTGGAAGCCTATTGGAAGGCCACACACCCGCCCAGCAGCACGCCACCC
AATCCGCTGCTGAACCGCACCATGGCTACCGCAGCCCTGGCTGCCAGCCCTGCCCCTGTC
TCCAACCTCCAGGGACCCTACCTTGCTTCCGGGGACCAGCCACTGGAACGGGCCACCGGG
GAGCACGCCAGCATGCACGAGTACCCAGGGGAGCTGGGCCAGCCCCCAGGCCTTTACCCC
AGCAGCCACCCACCAGGCCGGGCAGGCACGCTACGGGCACTGTCCCGCCAAGACACTTTT
GATGCCGACACCCCCGGCAGCCGAAACTCTGCCTACACGGAGCTGGGAGACTCATGTGTG
GACATGGAGACTGACCCCTCAGAGGGGCCAGGGCTTGGAGACCCTGCAGGGGGCGGCACG
CCCCCAGCCCGACAGGGATCCTGGGAGGACGAGGAAGAAGACTATGAGGAAGAGCTGACC
GACAACCGGAACCGGGGCCGGAATAAGGCCCGCTACTGCGCTGAGGGTGGGGGTCCAGTT
TTGGGGCGCAACAAGAATGAGCTGGAGGGCTGGGGACGAGGCGTCTACATTCGCTGA
Chromosome Location
17
Locus
17q21-q22
External Identifiers
ResourceLink
UniProtKB IDQ02641
UniProtKB Entry NameCACB1_HUMAN
GenBank Protein ID179806
GenBank Gene IDM92303
GenAtlas IDCACNB1
HGNC IDHGNC:1401
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00308IbutilideapprovedyesactivatorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB00653Magnesium sulfateapproved, investigational, vet_approvedunknownDetails
DB00661VerapamilapprovedyesinhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB00393Nimodipineapproved, investigationalyesinhibitorDetails
DB00898EthanolapprovedunknownDetails
DB09230AzelnidipineinvestigationalunknownagonistDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium Citrateapproved, investigationalunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedyesinhibitorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09236Lacidipineapproved, investigationalyesantagonistDetails
DB09231BenidipineexperimentalyesantagonistDetails
DB09232CilnidipineinvestigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB00825MentholapprovedyesantagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails