Voltage-dependent L-type calcium channel subunit beta-2

Details

Name
Voltage-dependent L-type calcium channel subunit beta-2
Synonyms
  • CAB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • Lambert-Eaton myasthenic syndrome antigen B
  • MYSB
Gene Name
CACNB2
Organism
Human
Amino acid sequence
>lcl|BSEQ0004623|Voltage-dependent L-type calcium channel subunit beta-2
MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIER
IFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTL
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHN
HRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
RHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
Number of residues
660
Molecular Weight
73579.925
Theoretical pI
8.26
GO Classification
Functions
voltage-gated calcium channel activity / calcium channel regulator activity / calcium channel activity
Processes
transport / positive regulation of calcium ion transport / synaptic transmission / visual perception / axon guidance / neuromuscular junction development / regulation of voltage-gated calcium channel activity / calcium ion import
Components
voltage-gated calcium channel complex / L-type voltage-gated calcium channel complex / integral component of plasma membrane
General Function
Voltage-gated calcium channel activity
Specific Function
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021669|Voltage-dependent L-type calcium channel subunit beta-2 (CACNB2)
ATGCAGTGCTGCGGGCTGGTGCATCGCCGGCGAGTACGGGTGTCCTATGGTTCGGCAGAC
TCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTG
CGCAGAGAAGCGGAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTT
GCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTG
CCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAAC
AATGACTGGTGGATAGGGCGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGC
CCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTC
TACTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCC
AGAAAATCAACACCTCCATCATCTGCTATAGACATAGATGCTACTGGCTTAGATGCAGAA
GAAAATGATATTCCAGCAAACCACCGCTCCCCTAAACCCAGTGCAAACAGTGTAACGTCA
CCCCACTCCAAAGAGAAAAGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTAT
GATGTGGTACCTTCCATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAG
GTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGG
ATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAAT
CCCAGTAAGCACGCAATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAG
AGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCG
GATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATAT
GTAAAGATTTCTTCTCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAA
GCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAG
CTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGAC
TATCTGGAGGCCTACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTC
CTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCA
CAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAA
GCTGAAGAAGAACCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCA
GCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTT
GACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCC
CATGACCACGTGGACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCAC
GGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAG
CAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGT
GAAAAGGATGGAGAAGTGATATCAAAAAAACGGAATGAGGCTGGGGAGTGGAACAGGGAT
GTTTACATCCGCCAATGA
Chromosome Location
10
Locus
10p12
External Identifiers
ResourceLink
UniProtKB IDQ08289
UniProtKB Entry NameCACB2_HUMAN
GenBank Protein ID300417
GenBank Gene IDS60415
GenAtlas IDCACNB2
HGNC IDHGNC:1402
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00653Magnesium sulfateapproved, investigational, vet_approvedunknownDetails
DB00661VerapamilapprovedyesinhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB00381AmlodipineapprovedyesinhibitorDetails
DB01023Felodipineapproved, investigationalyesinhibitorDetails
DB00270Isradipineapproved, investigationalyesinhibitorDetails
DB01115NifedipineapprovedyesinhibitorDetails
DB00393Nimodipineapproved, investigationalyesinhibitorDetails
DB00401NisoldipineapprovedyesinhibitorDetails
DB01054Nitrendipineapproved, investigationalyesinhibitorDetails
DB00622Nicardipineapproved, investigationalyesinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB06712Nilvadipineapproved, investigationalyesinhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium CitrateapprovedunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedyesinhibitorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09236Lacidipineapproved, investigationalyesantagonistDetails
DB09231Benidipineapproved, investigationalyesantagonistDetails
DB09232Cilnidipineapproved, investigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB00825MentholapprovedyesantagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails