Potassium voltage-gated channel subfamily H member 2

Details

Name
Potassium voltage-gated channel subfamily H member 2
Synonyms
  • Eag homolog
  • Eag-related protein 1
  • ERG
  • ERG-1
  • ERG1
  • Ether-a-go-go-related gene potassium channel 1
  • Ether-a-go-go-related protein 1
  • H-ERG
  • HERG
  • hERG-1
  • hERG1
  • Voltage-gated potassium channel subunit Kv11.1
Gene Name
KCNH2
Organism
Human
Amino acid sequence
>lcl|BSEQ0000180|Potassium voltage-gated channel subfamily H member 2
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSP
PRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA
PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY
FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE
VLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS
PRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP
SLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPG
QLGALTSQPLHRHGSDPGS
Number of residues
1159
Molecular Weight
126653.52
Theoretical pI
7.97
GO Classification
Functions
voltage-gated potassium channel activity / ubiquitin protein ligase binding / inward rectifier potassium channel activity / scaffold protein binding / delayed rectifier potassium channel activity / protein homodimerization activity / phosphorelay sensor kinase activity / voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization / identical protein binding / C3HC4-type RING finger domain binding
Processes
membrane repolarization during action potential / negative regulation of potassium ion export / membrane repolarization during cardiac muscle cell action potential / potassium ion export across plasma membrane / positive regulation of potassium ion transmembrane transport / regulation of heart rate by hormone / regulation of membrane repolarization / cardiac muscle contraction / synaptic transmission / membrane depolarization during action potential / potassium ion export / regulation of heart rate by cardiac conduction / regulation of potassium ion transmembrane transport / regulation of ventricular cardiac muscle cell membrane repolarization / ventricular cardiac muscle cell action potential / cellular response to drug / negative regulation of potassium ion transmembrane transport / potassium ion transmembrane transport / regulation of membrane potential / potassium ion homeostasis
Components
nuclear envelope / plasma membrane / voltage-gated potassium channel complex / cell surface / perinuclear region of cytoplasm
General Function
Voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization
Specific Function
Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr). Isoforms USO have no channel activity by themself, but modulates channel characteristics by forming heterotetramers with other isoforms which are retained intracellularly and undergo ubiquitin-dependent degradation.
Pfam Domain Function
Transmembrane Regions
404-424 451-471 496-516 521-541 548-568 639-659
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021259|Potassium voltage-gated channel subfamily H member 2 (KCNH2)
ATGCCGGTGCGGAGGGGCCACGTCGCGCCGCAGAACACCTTCCTGGACACCATCATCCGC
AAGTTTGAGGGCCAGAGCCGTAAGTTCATCATCGCCAACGCTCGGGTGGAGAACTGCGCC
GTCATCTACTGCAACGACGGCTTCTGCGAGCTGTGCGGCTACTCGCGGGCCGAGGTGATG
CAGCGACCCTGCACCTGCGACTTCCTGCACGGGCCGCGCACGCAGCGCCGCGCTGCCGCG
CAGATCGCGCAGGCACTGCTGGGCGCCGAGGAGCGCAAAGTGGAAATCGCCTTCTACCGG
AAAGATGGGAGCTGCTTCCTATGTCTGGTGGATGTGGTGCCCGTGAAGAACGAGGATGGG
GCTGTCATCATGTTCATCCTCAATTTCGAGGTGGTGATGGAGAAGGACATGGTGGGGTCC
CCGGCTCATGACACCAACCACCGGGGCCCCCCCACCAGCTGGCTGGCCCCAGGCCGCGCC
AAGACCTTCCGCCTGAAGCTGCCCGCGCTGCTGGCGCTGACGGCCCGGGAGTCGTCGGTG
CGGTCGGGCGGCGCGGGCGGCGCGGGCGCCCCGGGGGCCGTGGTGGTGGACGTGGACCTG
ACGCCCGCGGCACCCAGCAGCGAGTCGCTGGCCCTGGACGAAGTGACAGCCATGGACAAC
CACGTGGCAGGGCTCGGGCCCGCGGAGGAGCGGCGTGCGCTGGTGGGTCCCGGCTCTCCG
CCCCGCAGCGCGCCCGGCCAGCTCCCATCGCCCCGGGCGCACAGCCTCAACCCCGACGCC
TCGGGCTCCAGCTGCAGCCTGGCCCGGACGCGCTCCCGAGAAAGCTGCGCCAGCGTGCGC
CGCGCCTCGTCGGCCGACGACATCGAGGCCATGCGCGCCGGGGTGCTGCCCCCGCCACCG
CGCCACGCCAGCACCGGGGCCATGCACCCACTGCGCAGCGGCTTGCTCAACTCCACCTCG
GACTCCGACCTCGTGCGCTACCGCACCATTAGCAAGATTCCCCAAATCACCCTCAACTTT
GTGGACCTCAAGGGCGACCCCTTCTTGGCTTCGCCCACCAGTGACCGTGAGATCATAGCA
CCTAAGATAAAGGAGCGAACCCACAATGTCACTGAGAAGGTCACCCAGGTCCTGTCCCTG
GGCGCCGACGTGCTGCCTGAGTACAAGCTGCAGGCACCGCGCATCCACCGCTGGACCATC
CTGCATTACAGCCCCTTCAAGGCCGTGTGGGACTGGCTCATCCTGCTGCTGGTCATCTAC
ACGGCTGTCTTCACACCCTACTCGGCTGCCTTCCTGCTGAAGGAGACGGAAGAAGGCCCG
CCTGCTACCGAGTGTGGCTACGCCTGCCAGCCGCTGGCTGTGGTGGACCTCATCGTGGAC
ATCATGTTCATTGTGGACATCCTCATCAACTTCCGCACCACCTACGTCAATGCCAACGAG
GAGGTGGTCAGCCACCCCGGCCGCATCGCCGTCCACTACTTCAAGGGCTGGTTCCTCATC
GACATGGTGGCCGCCATCCCCTTCGACCTGCTCATCTTCGGCTCTGGCTCTGAGGAGCTG
ATCGGGCTGCTGAAGACTGCGCGGCTGCTGCGGCTGGTGCGCGTGGCGCGGAAGCTGGAT
CGCTACTCAGAGTACGGCGCGGCCGTGCTGTTCTTGCTCATGTGCACCTTTGCGCTCATC
GCGCACTGGCTAGCCTGCATCTGGTACGCCATCGGCAACATGGAGCAGCCACACATGGAC
TCACGCATCGGCTGGCTGCACAACCTGGGCGACCAGATAGGCAAACCCTACAACAGCAGC
GGCCTGGGCGGCCCCTCCATCAAGGACAAGTATGTGACGGCGCTCTACTTCACCTTCAGC
AGCCTCACCAGTGTGGGCTTCGGCAACGTCTCTCCCAACACCAACTCAGAGAAGATCTTC
TCCATCTGCGTCATGCTCATTGGCTCCCTCATGTATGCTAGCATCTTCGGCAACGTGTCG
GCCATCATCCAGCGGCTGTACTCGGGCACAGCCCGCTACCACACACAGATGCTGCGGGTG
CGGGAGTTCATCCGCTTCCACCAGATCCCCAATCCCCTGCGCCAGCGCCTCGAGGAGTAC
TTCCAGCACGCCTGGTCCTACACCAACGGCATCGACATGAACGCGGTGCTGAAGGGCTTC
CCTGAGTGCCTGCAGGCTGACATCTGCCTGCACCTGAACCGCTCACTGCTGCAGCACTGC
AAACCCTTCCGAGGGGCCACCAAGGGCTGCCTTCGGGCCCTGGCCATGAAGTTCAAGACC
ACACATGCACCGCCAGGGGACACACTGGTGCATGCTGGGGACCTGCTCACCGCCCTGTAC
TTCATCTCCCGGGGCTCCATCGAGATCCTGCGGGGCGACGTCGTCGTGGCCATCCTGGGG
AAGAATGACATCTTTGGGGAGCCTCTGAACCTGTATGCAAGGCCTGGCAAGTCGAACGGG
GATGTGCGGGCCCTCACCTACTGTGACCTACACAAGATCCATCGGGACGACCTGCTGGAG
GTGCTGGACATGTACCCTGAGTTCTCCGACCACTTCTGGTCCAGCCTGGAGATCACCTTC
AACCTGCGAGATACCAACATGATCCCGGGCTCCCCCGGCAGTACGGAGTTAGAGGGTGGC
TTCAGTCGGCAACGCAAGCGCAAGTTGTCCTTCCGCAGGCGCACGGACAAGGACACGGAG
CAGCCAGGGGAGGTGTCGGCCTTGGGGCCGGGCCGGGCGGGGGCAGGGCCGAGTAGCCGG
GGCCGGCCGGGGGGGCCGTGGGGGGAGAGCCCGTCCAGTGGCCCCTCCAGCCCTGAGAGC
AGTGAGGATGAGGGCCCAGGCCGCAGCTCCAGCCCCCTCCGCCTGGTGCCCTTCTCCAGC
CCCAGGCCCCCCGGAGAGCCGCCGGGTGGGGAGCCCCTGATGGAGGACTGCGAGAAGAGC
AGCGACACTTGCAACCCCCTGTCAGGCGCCTTCTCAGGAGTGTCCAACATTTTCAGCTTC
TGGGGGGACAGTCGGGGCCGCCAGTACCAGGAGCTCCCTCGATGCCCCGCCCCCACCCCC
AGCCTCCTCAACATCCCCCTCTCCAGCCCGGGTCGGCGGCCCCGGGGCGACGTGGAGAGC
AGGCTGGATGCCCTCCAGCGCCAGCTCAACAGGCTGGAGACCCGGCTGAGTGCAGACATG
GCCACTGTCCTGCAGCTGCTACAGAGGCAGATGACGCTGGTCCCGCCCGCCTACAGTGCT
GTGACCACCCCGGGGCCTGGCCCCACTTCCACATCCCCGCTGTTGCCCGTCAGCCCCCTC
CCCACCCTCACCTTGGACTCGCTTTCTCAGGTTTCCCAGTTCATGGCGTGTGAGGAGCTG
CCCCCGGGGGCCCCAGAGCTTCCCCAAGAAGGCCCCACACGACGCCTCTCCCTACCGGGC
CAGCTGGGGGCCCTCACCTCCCAGCCCCTGCACAGACACGGCTCGGACCCGGGCAGTTAG
Chromosome Location
7
Locus
7q35-q36
External Identifiers
ResourceLink
UniProtKB IDQ12809
UniProtKB Entry NameKCNH2_HUMAN
GenBank Protein ID487738
GenBank Gene IDU04270
GenAtlas IDKCNH2
HGNC IDHGNC:6251
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00308IbutilideapprovedyesinhibitorDetails
DB01182PropafenoneapprovedyesinhibitorDetails
DB00204Dofetilideapproved, investigationalyesinhibitorDetails
DB00276Amsacrineapproved, investigationalunknowninhibitorDetails
DB00489SotalolapprovedyesinhibitorDetails
DB00604Cisaprideapproved, investigational, withdrawnunknowninhibitorDetails
DB00637Astemizoleapproved, withdrawnunknowninhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB01100PimozideapprovedyesinhibitorDetails
DB01136Carvedilolapproved, investigationalunknowninhibitorDetails
DB01218HalofantrineapprovedyesinhibitorDetails
DB01118Amiodaroneapproved, investigationalyesinhibitorDetails
DB00342Terfenadineapproved, withdrawnunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB04957AzimilideinvestigationalunknownDetails
DB06144Sertindoleapproved, investigational, withdrawnunknowninhibitorDetails
DB00590DoxazosinapprovedunknowninhibitorDetails
DB01162TerazosinapprovedunknowninhibitorDetails
DB00457PrazosinapprovedunknowninhibitorDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00679Thioridazineapproved, withdrawnunknowninhibitorDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00458ImipramineapprovedunknowninhibitorDetails
DB01142Doxepinapproved, investigationalunknowninhibitorDetails
DB00346Alfuzosinapproved, investigationalunknowninhibitorDetails
DB00537Ciprofloxacinapproved, investigationalunknownDetails
DB01211ClarithromycinapprovedunknownDetails
DB00199Erythromycinapproved, investigational, vet_approvednoinhibitorDetails
DB06217Vernakalantapproved, investigationalunknownblockerDetails
DB06457TecastemizoleinvestigationalunknownDetails
DB00455Loratadineapproved, investigationalunknownDetails
DB01244Bepridilapproved, withdrawnunknowninhibitorDetails
DB00280DisopyramideapprovedunknowninhibitorDetails
DB01195Flecainideapproved, withdrawnunknowninhibitorDetails
DB00472Fluoxetineapproved, vet_approvedunknowninhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB01035ProcainamideapprovedunknowninhibitorDetails
DB00675TamoxifenapprovedunknowninhibitorDetails
DB01074Perhexilineapproved, investigationalunknownDetails
DB11386Chlorobutanolapproved, investigational, vet_approvedunknownDetails
DB00176Fluvoxamineapproved, investigationalunknownDetails
DB01149Nefazodoneapproved, withdrawnunknownantagonistDetails
DB12364Betrixabanapproved, investigationalunknowninhibitorDetails
DB11642Pitolisantapproved, investigationalnoblockerDetails
DB11633Isavuconazoleapproved, investigationalnoinhibitorDetails
DB11090Potassium nitrateapprovedunknownagonistDetails
DB11186Pentoxyverineapproved, investigationalunknowninhibitorDetails