Histone deacetylase 1

Details

Name
Histone deacetylase 1
Synonyms
  • 3.5.1.98
  • HD1
  • RPD3L1
Gene Name
HDAC1
Organism
Human
Amino acid sequence
>lcl|BSEQ0011697|Histone deacetylase 1
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Number of residues
482
Molecular Weight
55102.615
Theoretical pI
5.16
GO Classification
Functions
transcription regulatory region sequence-specific DNA binding / protein N-terminus binding / activating transcription factor binding / repressing transcription factor binding / core promoter binding / transcription factor activity, sequence-specific DNA binding / transcription regulatory region DNA binding / deacetylase activity / transcription factor binding / histone deacetylase binding / histone deacetylase activity / NAD-dependent histone deacetylase activity (H3-K14 specific) / NF-kappaB binding / RNA polymerase II transcription corepressor activity / enzyme binding / protein deacetylase activity / RNA polymerase II repressing transcription factor binding
Processes
transcription, DNA-templated / chromatin modification / chromatin remodeling / transforming growth factor beta receptor signaling pathway / ATP-dependent chromatin remodeling / negative regulation of gene expression, epigenetic / epidermal cell differentiation / negative regulation of gene expression / regulation of gene expression, epigenetic / eyelid development in camera-type eye / blood coagulation / positive regulation of transcription, DNA-templated / histone H3 deacetylation / negative regulation of apoptotic process / histone H4 deacetylation / neurotrophin TRK receptor signaling pathway / Notch signaling pathway / embryonic digit morphogenesis / negative regulation by host of viral transcription / positive regulation of transcription from RNA polymerase II promoter / negative regulation of transcription, DNA-templated / fungiform papilla formation / negative regulation of androgen receptor signaling pathway / positive regulation of cell proliferation / viral process / histone deacetylation / hair follicle placode formation / positive regulation of receptor biosynthetic process / negative regulation of transcription from RNA polymerase II promoter / chromatin organization / protein deacetylation / mitotic cell cycle / negative regulation of cell cycle / gene expression / odontogenesis of dentin-containing tooth / circadian regulation of gene expression / transcription initiation from RNA polymerase II promoter
Components
cytoplasm / cytosol / protein complex / nucleoplasm / histone deacetylase complex / nuclear chromatin / nucleus / chromatin / NuRD complex / Sin3 complex
General Function
Transcription regulatory region sequence-specific dna binding
Specific Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0011698|Histone deacetylase 1 (HDAC1)
ATGGCGCAGACGCAGGGCACCCGGAGGAAAGTCTGTTACTACTACGACGGGGATGTTGGA
AATTACTATTATGGACAAGGCCACCCAATGAAGCCTCACCGAATCCGCATGACTCATAAT
TTGCTGCTCAACTATGGTCTCTACCGAAAAATGGAAATCTATCGCCCTCACAAAGCCAAT
GCTGAGGAGATGACCAAGTACCACAGCGATGACTACATTAAATTCTTGCGCTCCATCCGT
CCAGATAACATGTCGGAGTACAGCAAGCAGATGCAGAGATTCAACGTTGGTGAGGACTGT
CCAGTATTCGATGGCCTGTTTGAGTTCTGTCAGTTGTCTACTGGTGGTTCTGTGGCAAGT
GCTGTGAAACTTAATAAGCAGCAGACGGACATCGCTGTGAATTGGGCTGGGGGCCTGCAC
CATGCAAAGAAGTCCGAGGCATCTGGCTTCTGTTACGTCAATGATATCGTCTTGGCCATC
CTGGAACTGCTAAAGTATCACCAGAGGGTGCTGTACATTGACATTGATATTCACCATGGT
GACGGCGTGGAAGAGGCCTTCTACACCACGGACCGGGTCATGACTGTGTCCTTTCATAAG
TATGGAGAGTACTTCCCAGGAACTGGGGACCTACGGGATATCGGGGCTGGCAAAGGCAAG
TATTATGCTGTTAACTACCCGCTCCGAGACGGGATTGATGACGAGTCCTATGAGGCCATT
TTCAAGCCGGTCATGTCCAAAGTAATGGAGATGTTCCAGCCTAGTGCGGTGGTCTTACAG
TGTGGCTCAGACTCCCTATCTGGGGATCGGTTAGGTTGCTTCAATCTAACTATCAAAGGA
CACGCCAAGTGTGTGGAATTTGTCAAGAGCTTTAACCTGCCTATGCTGATGCTGGGAGGC
GGTGGTTACACCATTCGTAACGTTGCCCGGTGCTGGACATATGAGACAGCTGTGGCCCTG
GATACGGAGATCCCTAATGAGCTTCCATACAATGACTACTTTGAATACTTTGGACCAGAT
TTCAAGCTCCACATCAGTCCTTCCAATATGACTAACCAGAACACGAATGAGTACCTGGAG
AAGATCAAACAGCGACTGTTTGAGAACCTTAGAATGCTGCCGCACGCACCTGGGGTCCAA
ATGCAGGCGATTCCTGAGGACGCCATCCCTGAGGAGAGTGGCGATGAGGACGAAGACGAC
CCTGACAAGCGCATCTCGATCTGCTCCTCTGACAAACGAATTGCCTGTGAGGAAGAGTTC
TCCGATTCTGAAGAGGAGGGAGAGGGGGGCCGCAAGAACTCTTCCAACTTCAAAAAAGCC
AAGAGAGTCAAAACAGAGGATGAAAAAGAGAAAGACCCAGAGGAGAAGAAAGAAGTCACC
GAAGAGGAGAAAACCAAGGAGGAGAAGCCAGAAGCCAAAGGGGTCAAGGAGGAGGTCAAG
TTGGCCTGA
Chromosome Location
1
Locus
1p34
External Identifiers
ResourceLink
UniProtKB IDQ13547
UniProtKB Entry NameHDAC1_HUMAN
GenBank Protein ID1277084
GenBank Gene IDU50079
GenAtlas IDHDAC1
HGNC IDHGNC:4852
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02546Vorinostatapproved, investigationalyesinhibitorDetails
DB05223PracinostatinvestigationalunknownDetails
DB11830MocetinostatinvestigationalunknownDetails
DB12565AbexinostatinvestigationalunknownDetails
DB06176Romidepsinapproved, investigationalyesantagonistinhibitorDetails
DB01593Zincapproved, investigationalunknowncofactorDetails
DB01169Arsenic trioxideapproved, investigationalunknownDetails
DB08868Fingolimodapproved, investigationalunknowninhibitorDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails
DB05015Belinostatapproved, investigationalyesinhibitorDetails
DB06603Panobinostatapproved, investigationalyesinhibitorDetails