ATP-sensitive inward rectifier potassium channel 11

Details

Name
ATP-sensitive inward rectifier potassium channel 11
Synonyms
  • IKATP
  • Inward rectifier K(+) channel Kir6.2
  • Potassium channel, inwardly rectifying subfamily J member 11
Gene Name
KCNJ11
Organism
Human
Amino acid sequence
>lcl|BSEQ0001412|ATP-sensitive inward rectifier potassium channel 11
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS
Number of residues
390
Molecular Weight
43540.375
Theoretical pI
8.1
GO Classification
Functions
ATP binding / voltage-gated potassium channel activity / ankyrin binding / ion channel binding / ATP-activated inward rectifier potassium channel activity / potassium ion binding
Processes
potassium ion import / response to ATP / glucose metabolic process / neurological system process / regulation of ion transmembrane transport / transmembrane transport / response to drug / cellular response to tumor necrosis factor / cellular response to glucose stimulus / response to estradiol / cellular response to nicotine / energy reserve metabolic process / regulation of membrane potential / positive regulation of cation channel activity / regulation of insulin secretion / negative regulation of insulin secretion / synaptic transmission / response to ischemia / small molecule metabolic process / response to testosterone / potassium ion transmembrane transport
Components
mitochondrion / nuclear envelope / myelin sheath / intercalated disc / endoplasmic reticulum / integral component of plasma membrane / T-tubule / ATP-sensitive potassium channel complex / cell body fiber / plasma membrane / neuronal cell body / voltage-gated potassium channel complex / endosome / axolemma / cytosol
General Function
Voltage-gated potassium channel activity
Specific Function
This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium (By similarity). Subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with ABCC9. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.
Pfam Domain Function
Transmembrane Regions
69-93 145-166
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0001411|1173 bp
ATGCTGTCCCGCAAGGGCATCATCCCCGAGGAATACGTGCTGACACGCCTGGCAGAGGAC
CCTGCCGAGCCCAGGTACCGTGCCCGCCAGCGGAGGGCCCGCTTTGTGTCCAAGAAAGGC
AACTGCAACGTGGCCCACAAGAACATCCGGGAGCAGGGCCGCTTCCTGCAGGACGTGTTC
ACCACGCTGGTGGACCTCAAGTGGCCACACACATTGCTCATCTTCACCATGTCCTTCCTG
TGCAGCTGGCTGCTCTTCGCCATGGCCTGGTGGCTCATCGCCTTCGCCCACGGTGACCTG
GCCCCCAGCGAGGGCACTGCTGAGCCCTGTGTCACCAGCATCCACTCCTTCTCGTCTGCC
TTCCTTTTCTCCATTGAGGTCCAAGTGACTATTGGCTTTGGGGGGCGCATGGTGACTGAG
GAGTGCCCACTGGCCATCCTGAGCCTCATCGTGCAGAACATCGTGGGGCTCATGATCAAC
GCCATCATGCTTGGCTGCATCTTCATGAAGACTGCCCAAGCCCACCGCAGGGCTGAGACC
CTCATCTTCAGCAAGCATGCGGTGATCGCTCTGCGCCACGGCCGCCTCTGCTTCATGCTA
CGTGTGGGTGACCTCCGCAAGAGCATGATCATCAGCGCCACCATCCACATGCAGGTGGTA
CGCAAGACCACCAGCCCCGAGGGCGAGGTGGTGCCCCTCCACCAGGTGGACATCCCCATG
GAGAACGGCGTGGGTGGCAACAGCATCTTCCTGGTGGCCCCGCTGATCATCTACCATGTC
ATTGATGCCAACAGCCCACTCTACGACCTGGCACCCAGCGACCTGCACCACCACCAGGAC
CTCGAGATCATCGTCATCCTGGAAGGCGTGGTGGAAACCACGGGCATCACCACCCAGGCC
CGCACCTCCTACCTGGCCGATGAGATCCTGTGGGGCCAGCGCTTTGTGCCCATTGTAGCT
GAGGAGGACGGACGTTACTCTGTGGACTACTCCAAGTTTGGCAACACCATCAAAGTGCCC
ACACCACTCTGCACGGCCCGCCAGCTTGATGAGGACCACAGCCTACTGGAAGCTCTGACC
CTCGCCTCAGCCCGCGGGCCCCTGCGCAAGCGCAGCGTGCCCATGGCCAAGGCCAAGCCC
AAGTTCAGCATCTCTCCAGATTCCCTGTCCTGA
Chromosome Location
Not Available
Locus
11p15.1
External Identifiers
ResourceLink
UniProtKB IDQ14654
UniProtKB Entry NameKCJ11_HUMAN
GenBank Protein ID1088445
GenBank Gene IDD50582
GenAtlas IDKCNJ11
HGNC IDHGNC:6257
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00308IbutilideapprovedunknowninhibitorDetails
DB00222GlimepirideapprovedyesinhibitorDetails
DB01119DiazoxideapprovedyesinducerDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00922Levosimendanapproved, investigationalyesinducerDetails
DB01154Thiamylalapproved, vet_approvedyesinhibitorDetails
DB11633Isavuconazoleapproved, investigationalnoinhibitorDetails
DB01392Yohimbineapproved, investigational, vet_approvedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesantagonistDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB00839Tolazamideapproved, investigationalyesblockerDetails
DB01016GlyburideapprovedyesblockerDetails