Sodium/bile acid cotransporter
Details
- Name
- Sodium/bile acid cotransporter
- Synonyms
- Cell growth-inhibiting gene 29 protein
- Na(+)/bile acid cotransporter
- Na(+)/taurocholate transport protein
- NTCP
- Sodium/taurocholate cotransporting polypeptide
- Solute carrier family 10 member 1
- Gene Name
- SLC10A1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0017172|Sodium/bile acid cotransporter MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKG LAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSI VMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKR PQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLL IAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
- Number of residues
- 349
- Molecular Weight
- 38118.64
- Theoretical pI
- 8.94
- GO Classification
- Functionsbile acid / virus receptor activityProcessesbile acid and bile salt transport / bile acid metabolic process / small molecule metabolic process / transportComponentsbasolateral plasma membrane / integral component of plasma membrane / plasma membrane
- General Function
- Virus receptor activity
- Specific Function
- The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.(Microbial infection) Acts as a receptor for hepatitis B virus.
- Pfam Domain Function
- SBF (PF01758)
- Transmembrane Regions
- 25-45 60-80 91-111 120-140 156-176 191-211 220-240 283-303
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0017173|Sodium/bile acid cotransporter (SLC10A1) ATGGAGGCCCACAACGCGTCTGCCCCATTCAACTTCACCCTGCCACCCAACTTTGGCAAG CGCCCCACAGACCTGGCACTGAGCGTCATCCTGGTGTTCATGTTGTTCTTCATCATGCTC TCGCTGGGCTGCACCATGGAGTTCAGCAAGATCAAGGCTCACTTATGGAAGCCTAAAGGG CTGGCCATCGCCCTGGTGGCACAGTATGGCATCATGCCCCTCACGGCCTTTGTGCTGGGC AAGGTCTTCCGGCTGAAGAACATTGAGGCACTGGCCATCTTGGTCTGTGGCTGCTCACCT GGAGGGAACCTGTCCAATGTCTTCAGTCTGGCCATGAAGGGGGACATGAACCTCAGCATT GTGATGACCACCTGCTCCACCTTCTGTGCCCTTGGCATGATGCCTCTCCTCCTGTACATC TACTCCAGGGGGATCTATGATGGGGACCTGAAGGACAAGGTGCCCTATAAAGGCATCGTG ATATCACTGGTCCTGGTTCTCATTCCTTGCACCATAGGGATCGTCCTCAAATCCAAACGG CCACAATACATGCGCTATGTCATCAAGGGAGGGATGATCATCATTCTCTTGTGCAGTGTG GCCGTCACAGTTCTCTCTGCCATCAATGTGGGGAAGAGCATCATGTTTGCCATGACACCA CTCTTGATTGCCACCTCCTCCCTGATGCCTTTTATTGGCTTTCTGCTGGGTTATGTTCTC TCTGCTCTCTTCTGCCTCAATGGACGGTGCAGACGCACTGTCAGCATGGAGACTGGATGC CAAAATGTCCAACTCTGTTCCACCATCCTCAATGTGGCCTTTCCACCTGAAGTCATTGGA CCACTTTTCTTCTTTCCCCTCCTCTACATGATTTTCCAGCTTGGAGAAGGGCTTCTCCTC ATTGCCATATTTTGGTGCTATGAGAAATTCAAGACTCCCAAGGATAAAACAAAAATGATC TACACAGCTGCCACAACTGAAGAAACAATTCCAGGAGCTCTGGGAAATGGCACCTACAAA GGGGAGGACTGCTCCCCTTGCACAGCCTAG
- Chromosome Location
- 14
- Locus
- 14q24.1
- External Identifiers
Resource Link UniProtKB ID Q14973 UniProtKB Entry Name NTCP_HUMAN GenBank Protein ID 410214 GenBank Gene ID L21893 HGNC ID HGNC:10905 - General References
- Hagenbuch B, Meier PJ: Molecular cloning, chromosomal localization, and functional characterization of a human liver Na+/bile acid cotransporter. J Clin Invest. 1994 Mar;93(3):1326-31. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Yan H, Zhong G, Xu G, He W, Jing Z, Gao Z, Huang Y, Qi Y, Peng B, Wang H, Fu L, Song M, Chen P, Gao W, Ren B, Sun Y, Cai T, Feng X, Sui J, Li W: Sodium taurocholate cotransporting polypeptide is a functional receptor for human hepatitis B and D virus. Elife. 2012 Nov 13;1:e00049. doi: 10.7554/eLife.00049. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00977 Ethinylestradiol approved unknown inhibitor Details DB00624 Testosterone approved, investigational unknown inhibitor Details DB00396 Progesterone approved, vet_approved unknown inhibitor Details DB00286 Conjugated estrogens approved unknown inhibitor Details DB00091 Cyclosporine approved, investigational, vet_approved unknown inhibitor Details DB02659 Cholic Acid approved unknown substrateinhibitor Details DB00887 Bumetanide approved unknown substrateinhibitor Details DB01032 Probenecid approved, investigational unknown inhibitor Details DB01586 Ursodeoxycholic acid approved, investigational unknown substrateinhibitor Details DB04348 Taurocholic acid approved, experimental unknown substrate Details DB00279 Liothyronine approved, vet_approved unknown substrate Details DB00328 Indomethacin approved, investigational unknown substrate Details DB03619 Deoxycholic acid approved unknown substrate Details DB02123 Glycochenodeoxycholic Acid experimental unknown substrate Details DB01583 Liotrix approved unknown substrate Details DB08860 Pitavastatin approved unknown substrate Details DB06290 Simeprevir approved unknown inhibitor Details DB13943 Testosterone cypionate approved unknown inhibitor Details DB13944 Testosterone enanthate approved unknown inhibitor Details DB13946 Testosterone undecanoate approved, investigational unknown inhibitor Details DB01098 Rosuvastatin approved unknown Details DB09100 Thyroid, porcine approved unknown substrate Details DB14761 Remdesivir approved, investigational unknown inhibitor Details DB15248 Bulevirtide approved, investigational yes inhibitor Details DB15688 Zavegepant approved, investigational unknown substrate Details DB00412 Rosiglitazone approved, investigational unknown inhibitor Details DB00549 Zafirlukast approved, investigational unknown inhibitor Details DB03604 Tiratricol investigational unknown inhibitor Details DB00795 Sulfasalazine approved unknown inhibitor Details DB13215 Sulfobromophthalein experimental unknown inhibitor Details DB04574 Estrone sulfate approved unknown inhibitor Details DB15059 Aprocitentan approved, investigational no inhibitor Details