Cocaine- and amphetamine-regulated transcript protein

Details

Name
Cocaine- and amphetamine-regulated transcript protein
Synonyms
  • CART
Gene Name
CARTPT
Organism
Human
Amino acid sequence
>lcl|BSEQ0010611|Cocaine- and amphetamine-regulated transcript protein
MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Number of residues
116
Molecular Weight
12828.975
Theoretical pI
8.37
GO Classification
Processes
signal transduction / cellular response to starvation / adult feeding behavior / neuropeptide signaling pathway / cellular glucose homeostasis / cell-cell signaling / circadian regulation of gene expression / synaptic transmission / negative regulation of appetite / negative regulation of bone resorption / activation of MAPKK activity / negative regulation of glucagon secretion / G-protein coupled receptor signaling pathway / negative regulation of osteoclast differentiation / regulation of insulin secretion / positive regulation of epinephrine secretion / positive regulation of blood pressure / somatostatin secretion / positive regulation of transmission of nerve impulse
Components
extracellular space / secretory granule
General Function
Not Available
Specific Function
Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0010612|Cocaine- and amphetamine-regulated transcript protein (CARTPT)
ATGGAGAGCTCCCGCGTGAGGCTGCTGCCCCTCCTGGGCGCCGCCCTGCTGCTGATGCTA
CCTCTGTTGGGTACCCGTGCCCAGGAGGACGCCGAGCTCCAGCCCCGAGCCCTGGACATC
TACTCTGCCGTGGATGATGCCTCCCACGAGAAGGAGCTGATCGAAGCGCTGCAAGAAGTC
TTGAAGAAGCTCAAGAGTAAACGTGTTCCCATCTATGAGAAGAAGTATGGCCAAGTCCCC
ATGTGTGACGCCGGTGAGCAGTGTGCAGTGAGGAAAGGGGCAAGGATCGGGAAGCTGTGT
GACTGTCCCCGAGGAACCTCCTGCAATTCCTTCCTCCTGAAGTGCTTATGA
Chromosome Location
5
Locus
5q13.2
External Identifiers
ResourceLink
UniProtKB IDQ16568
UniProtKB Entry NameCART_HUMAN
GenBank Protein ID609306
GenBank Gene IDU16826
GenAtlas IDCARTPT
HGNC IDHGNC:24323
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00182Amphetamineapproved, illicit, investigationalyesagonistDetails