Multidrug resistance-associated protein 7

Details

Name
Multidrug resistance-associated protein 7
Synonyms
  • ATP-binding cassette sub-family C member 10
  • MRP7
  • SIMRP7
Gene Name
ABCC10
Organism
Human
Amino acid sequence
>lcl|BSEQ0007017|Multidrug resistance-associated protein 7
MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYIL
PCSPGWRLRLAASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALW
VLAHSPHGHSRGPLALALVALLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLA
ALLAYALGWAAPGGPREPWAQEPLLPEDQEPEVAEDGESWLSRFSYAWLAPLLARGACGE
LRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGAFGRCYLALGLLKLVGTMLGF
SGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYKVTLQARGAVL
NILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG
VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQA
LGARVEACRARELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTA
LALVRMLILPLNNFPWVINGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLEL
HGALFSWDPVGTSLETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVR
GLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLEACALNDDLSILPAGDQTEVG
EKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCILGMLSYTTRLL
CTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP
EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRN
AADWWLSHWISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNG
SSDIRFYLTVYATIAGVNSLCTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATP
TGRILNRFSSDVACADDSLPFILNILLANAAGLLGLLAVLGSGLPWLLLLLPPLSIMYYH
VQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRATGATYRFEEENLRLLELNQRC
QFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSYALSLTGLLSG
LVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP
NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLR
SQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGR
SLSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRL
NTILNSDRVLVLQAGRVVELDSPATLRNQPHSLFQQLLQSSQQGVPASLGGP
Number of residues
1492
Molecular Weight
161627.375
Theoretical pI
7.07
GO Classification
Functions
ATP binding / ATPase activity, coupled to transmembrane movement of substances
Processes
transmembrane transport
Components
plasma membrane / integral component of membrane / lysosomal membrane
General Function
Atpase activity, coupled to transmembrane movement of substances
Specific Function
ATP-dependent transporter probably involved in cellular detoxification through lipophilic anion extrusion.
Pfam Domain Function
Transmembrane Regions
32-52 70-90 102-122 133-153 172-192 293-313 320-340 391-411 414-434 507-527 538-558 875-895 933-953 974-994 1051-1071 1153-1173 1182-1202
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019454|Multidrug resistance-associated protein 7 (ABCC10)
ATGGAACGACTTCTGGCCCAGCTGTGCGGCAGCAGCGCAGCGTGGCCGCTCCCGCTGTGG
GAGGGGGACACCACAGGCCACTGCTTCACCCAGCTGGTGCTCAGCGCCCTGCCCCACGCG
CTCCTCGCCGTGCTCAGTGCCTGTTACTTGGGCACCCCGAGGAGTCCAGATTACATCCTA
CCCTGCAGTCCTGGATGGCGCCTCCGACTTGCAGCTTCCTTCCTGCTTTCCGTCTTCCCG
CTGCTAGACCTTCTTCCAGTTGCTTTGCCACCAGGGGCAGGCCCAGGACCCATAGGGCTA
GAGGTGTTGGCAGGGTGCGTGGCAGCTGTGGCCTGGATCAGCCACAGCCTGGCCCTGTGG
GTGTTGGCACATTCCCCTCATGGCCACTCCCGGGGTCCCTTGGCCTTGGCCCTGGTAGCC
TTGCTGCCAGCTCCAGCCCTAGTGCTGACCGTGTTGTGGCATTGCCAGCGAGGCACACTT
CTGCCCCCACTTCTCCCAGGGCCCATGGCCCGCCTATGCTTGCTCATCCTGCAGCTGGCT
GCACTCTTGGCCTATGCACTGGGATGGGCAGCTCCTGGGGGACCACGAGAACCCTGGGCT
CAGGAGCCCCTCCTGCCCGAGGATCAAGAACCTGAGGTGGCTGAAGATGGGGAGAGTTGG
CTGTCACGCTTTTCCTATGCCTGGCTGGCACCCTTGCTGGCCCGTGGGGCCTGTGGAGAG
CTCCGGCAGCCTCAGGACATTTGCCGCCTCCCCCACAGACTGCAGCCAACCTACCTGGCT
CGTGTCTTCCAGGCACACTGGCAGGAGGGGGCACGGCTGTGGAGGGCCTTGTATGGGGCC
TTTGGACGGTGCTATCTGGCACTTGGACTGCTGAAGCTGGTGGGGACCATGTTGGGATTC
TCAGGGCCCCTGTTGCTCTCCCTACTGGTGGGCTTCCTGGAAGAGGGGCAGGAGCCACTA
AGCCACGGCCTGCTCTATGCTCTGGGGCTAGCCGGTGGGGCTGTGCTGGGTGCTGTGCTG
CAGAATCAGTATGGGTATGAGGTATATAAGGTAACACTTCAGGCACGGGGGGCTGTGCTG
AACATCCTGTACTGCAAGGCTTTACAGCTGGGGCCCAGCCGCCCTCCTACTGGGGAGGCC
CTGAACCTACTAGGCACTGACTCTGAACGGCTGCTTAACTTTGCTGGGAGCTTCCATGAA
GCCTGGGGCCTGCCCCTGCAACTGGCCATCACCCTCTACCTGCTGTACCAGCAGGTAGGC
GTGGCCTTCGTGGGTGGTCTCATCTTGGCACTGCTGCTGGTACCCGTCAACAAAGTGATT
GCCACCCGCATCATGGCCAGCAACCAGGAAATGCTACAGCACAAGGATGCGCGGGTTAAG
CTTGTGACAGAGCTGCTGAGTGGCATTCGGGTCATCAAGTTCTGCGGGTGGGAGCAGGCA
CTGGGAGCCCGAGTAGAGGCCTGCCGGGCTCGAGAGCTGGGGCGACTCCGGGTCATCAAA
TACCTGGATGCGGCCTGTGTATACCTGTGGGCTGCCCTACCGGTTGTCATCTCCATCGTT
ATCTTCATCACCTATGTCCTCATGGGGCACCAGCTCACTGCCACCAAGGTGTTCACGGCC
CTGGCACTGGTGCGAATGCTCATTCTTCCTCTCAACAACTTCCCTTGGGTGATCAATGGT
CTCCTGGAGGCCAAAGTGTCCTTGGACCGGATCCAGCTTTTCCTCGACCTTCCAAACCAC
AACCCCCAGGCCTACTACAGCCCAGATCCCCCTGCAGAGCCATCTACAGTATTGGAGCTG
CATGGAGCCTTGTTCTCCTGGGACCCAGTTGGAACCAGCCTGGAGACCTTCATCAGTCAT
CTCGAAGTGAAAAAGGGTATGCTGGTGGGCATCGTGGGGAAGGTCGGCTGTGGGAAGAGC
TCCCTGCTGGCTGCCATCGCTGGAGAGCTCCACAGGCTGCGTGGGCATGTGGCAGTGCGG
GGGCTGTCCAAGGGCTTTGGCCTGGCCACCCAGGAACCCTGGATCCAGTTTGCCACCATC
CGAGACAACATCCTCTTTGGGAAGACATTTGATGCACAGCTGTACAAGGAGGTGCTAGAA
GCCTGCGCCCTCAATGATGACCTCAGTATCCTGCCTGCTGGAGACCAGACAGAGGTGGGG
GAGAAGGGTGTCACCCTTAGCGGAGGACAGCGTGCCCGGATTGCCCTTGCTCGTGCTGTC
TACCAGGAAAAGGAGCTCTATCTCCTCGATGACCCTCTGGCCGCTGTGGATGCAGATGTG
GCCAACCACCTGCTGCACAGGTGCATCCTGGGCATGCTGAGCTACACCACACGGCTGCTC
TGCACCCACCGCACTGAGTACCTGGAGAGGGCTGACGCGGTGCTGCTGATGGAGGCCGGG
CGCCTCATCCGGGCTGGACCTCCCTCTGAGATTCTGCCACTGGTACAAGCTGTCCCCAAA
GCCTGGGCTGAGAATGGACAAGAGTCTGACTCAGCCACAGCCCAGTCAGTACAGAACCCA
GAGAAAACAAAGGAGGGGCTGGAGGAGGAGCAGAGCACATCTGGTCGCCTGCTGCAGGAA
GAAAGCAAGAAGGAGGGCGCCGTGGCCTTGCACGTGTACCAAGCTTACTGGAAGGCCGTG
GGCCAGGGCTTGGCCTTAGCCATCCTCTTCTCTCTGCTTCTCATGCAAGCCACGCGGAAC
GCTGCTGACTGGTGGCTCTCCCACTGGATCTCTCAGCTGAAGGCTGAGAATAGCTCCCAG
GAGGCGCAACCCTCCACCAGCCCAGCTTCTATGGGGCTCTTCTCTCCGCAGCTGCTCCTC
TTTTCCCCTGGAAACCTCTACATCCCAGTGTTCCCACTGCCCAAAGCTGCCCCCAATGGC
TCCTCAGACATCCGTTTCTACCTCACCGTGTATGCGACCATTGCTGGTGTAAATTCCCTC
TGCACCCTTCTCCGGGCAGTGCTCTTTGCAGCAGGCACCCTTCAAGCAGCTGCCACTCTG
CATCGCCGCCTGCTGCATCGAGTCCTTATGGCACCAGTGACTTTCTTCAATGCCACACCC
ACGGGCCGGATCCTAAACCGCTTCTCCTCTGATGTGGCCTGTGCGGATGACAGCCTGCCC
TTCATCCTCAACATCCTCCTGGCCAACGCGGCAGGCCTGCTGGGGCTCCTGGCCGTGCTG
GGCTCTGGCCTGCCCTGGCTGCTGCTCCTGCTGCCGCCTTTGAGCATCATGTACTATCAC
GTGCAGCGCCACTACAGGGCCTCCTCACGGGAGCTGCGGCGCCTGGGCAGCCTCACCCTG
TCTCCACTGTATAGCCATCTGGCCGATACCTTGGCTGGCCTCTCTGTGCTCCGGGCCACA
GGGGCCACCTACAGGTTTGAGGAGGAGAACCTGCGACTCCTTGAGCTAAACCAGAGGTGC
CAGTTTGCCACCAGTGCCACAATGCAGTGGCTGGACATTCGGCTACAGCTCATGGGGGCG
GCAGTGGTCAGCGCTATCGCAGGCATCGCTCTGGTGCAGCACCAGCAGGGCCTCGCTAAC
CCAGGGCTGGTGGGCTTGTCGCTGTCTTATGCCCTGTCCCTGACGGGCCTGCTCTCGGGC
CTGGTGAGCAGCTTCACACAGACAGAGGCCATGCTGGTGAGCGTCGAGCGGCTGGAAGAG
TACACCTGTGACCTGCCCCAGGAACCCCAGGGCCAGCCACTGCAGCTGGGCACCGGCTGG
CTGACCCAGGGGGGCGTGGAGTTCCAGGACGTGGTGTTGGCGTACCGGCCAGGGCTGCCG
AATGCCCTGGATGGAGTGACCTTCTGCGTGCAGCCTGGAGAGAAGTTGGGCATCGTGGGC
CGCACAGGCTCCGGCAAGTCTTCCCTGTTGTTGGTGCTCTTCCGGCTGCTAGAGCCCAGT
TCAGGGCGAGTGCTGCTGGACGGCGTGGACACCAGCCAGCTGGAGCTGGCCCAGCTCAGA
TCCCAGTTGGCTATCATCCCCCAGGAGCCCTTTTTGTTCAGTGGGACTGTTCGGGAAAAC
CTGGACCCCCAGGGCCTACATAAGGACAGGGCCTTGTGGCAGGCCCTGAAGCAGTGCCAC
CTGAGTGAGGTGATTACATCCATGGGTGGTCTGGATGGTGAGCTGGGTGAGGGGGGCCGG
AGCTTATCTCTTGGGCAGAGGCAGCTGTTGTGTTTGGCCAGGGCTCTCCTCACAGATGCC
AAGATCCTGTGTATCGATGAGGCCACAGCAAGTGTGGACCAGAAGACAGACCAGCTGCTC
CAGCAGACCATCTGCAAACGCTTTGCCAACAAGACAGTGCTGACCATTGCCCATAGGCTC
AACACGATCCTGAACTCAGACCGGGTGCTGGTGCTACAAGCGGGGAGAGTGGTAGAGCTG
GACTCCCCGGCCACCCTGCGCAACCAGCCCCACTCCCTGTTCCAGCAGCTGCTGCAGAGC
AGCCAGCAGGGAGTCCCTGCCTCACTCGGAGGTCCCTGA
Chromosome Location
6
Locus
6p21.1
External Identifiers
ResourceLink
UniProtKB IDQ5T3U5
UniProtKB Entry NameMRP7_HUMAN
GenBank Protein ID21103955
GenBank Gene IDAY032599
HGNC IDHGNC:52
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00541Vincristineapproved, investigationalunknownsubstrateinhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateinhibitorDetails
DB04348Taurocholic AcidexperimentalunknowninhibitorDetails
DB00203Sildenafilapproved, investigationalunknowninhibitorDetails
DB00563MethotrexateapprovedunknowninhibitorDetails
DB00773EtoposideapprovedunknownsubstrateinhibitorDetails
DB00997Doxorubicinapproved, investigationalunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB00987Cytarabineapproved, investigationalunknownsubstrateDetails
DB00694DaunorubicinapprovedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB00441GemcitabineapprovedunknownsubstrateDetails
DB00300Tenofovir disoproxilapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails