60S ribosomal protein L24, putative
Details
- Name
- 60S ribosomal protein L24, putative
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Plasmodium falciparum (isolate 3D7)
- Amino acid sequence
>lcl|BSEQ0051488|60S ribosomal protein L24, putative MSQIKTTVKTEACSFSEYRIYPGRGQKYIARDGKVYFYLSSKFASLALQKKKAAKLRWTQ TWRRNNKKTKIETTQRRRYKKTIKVQKAVCGLTVEDIRNRKAYVQSIEAKNKAKFGTKEK EDKKKTKDDKKKNLVHFQQKKDFTKSKMLNMAKSKMHKMMKK
- Number of residues
- 162
- Molecular Weight
- 19244.665
- Theoretical pI
- Not Available
- GO Classification
- FunctionsRNA binding / structural constituent of ribosomeProcessesassembly of large subunit precursor of preribosome / ribosomal large subunit assembly / translationComponentscytosolic large ribosomal subunit
- General Function
- Not Available
- Specific Function
- Rna binding
- Pfam Domain Function
- Ribosomal_L24e (PF01246)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051489|60S ribosomal protein L24, putative ATGTCACAAATTAAAACTACTGTAAAAACTGAAGCCTGTTCATTTAGTGAGTATAGGATA TACCCAGGAAGAGGTCAGAAATATATAGCAAGAGATGGAAAGGTTTATTTTTATTTATCA TCAAAATTTGCTTCCTTAGCTTTACAAAAGAAGAAGGCAGCTAAACTAAGATGGACACAA ACATGGAGAAGAAATAACAAAAAAACAAAAATTGAAACAACTCAAAGAAGGAGATACAAG AAAACTATAAAAGTACAAAAGGCTGTATGTGGATTGACCGTTGAAGATATAAGAAATAGA AAAGCTTATGTCCAAAGCATAGAAGCAAAAAACAAGGCCAAATTTGGAACAAAGGAAAAA GAAGATAAGAAAAAAACAAAAGACGACAAGAAAAAAAACCTTGTACATTTTCAACAGAAA AAAGATTTTACAAAATCAAAAATGTTAAATATGGCTAAAAGTAAAATGCATAAAATGATG AAAAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q8IEM3 UniProtKB Entry Name Q8IEM3_PLAF7 - General References
- Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [Article]
- Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R, Baker S, Barron A, Brooks K, Buckee CO, Burrows C, Cherevach I, Chillingworth C, Chillingworth T, Christodoulou Z, Clark L, Clark R, Corton C, Cronin A, Davies R, Davis P, Dear P, Dearden F, Doggett J, Feltwell T, Goble A, Goodhead I, Gwilliam R, Hamlin N, Hance Z, Harper D, Hauser H, Hornsby T, Holroyd S, Horrocks P, Humphray S, Jagels K, James KD, Johnson D, Kerhornou A, Knights A, Konfortov B, Kyes S, Larke N, Lawson D, Lennard N, Line A, Maddison M, McLean J, Mooney P, Moule S, Murphy L, Oliver K, Ormond D, Price C, Quail MA, Rabbinowitsch E, Rajandream MA, Rutter S, Rutherford KM, Sanders M, Simmonds M, Seeger K, Sharp S, Smith R, Squares R, Squares S, Stevens K, Taylor K, Tivey A, Unwin L, Whitehead S, Woodward J, Sulston JE, Craig A, Newbold C, Barrell BG: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13. Nature. 2002 Oct 3;419(6906):527-31. [Article]
- Wong W, Bai XC, Brown A, Fernandez IS, Hanssen E, Condron M, Tan YH, Baum J, Scheres SH: Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine. Elife. 2014 Jun 9;3. doi: 10.7554/eLife.03080. [Article]
- Sun M, Li W, Blomqvist K, Das S, Hashem Y, Dvorin JD, Frank J: Dynamical features of the Plasmodium falciparum ribosome during translation. Nucleic Acids Res. 2015 Dec 2;43(21):10515-24. doi: 10.1093/nar/gkv991. Epub 2015 Oct 1. [Article]
- Wong W, Bai XC, Sleebs BE, Triglia T, Brown A, Thompson JK, Jackson KE, Hanssen E, Marapana DS, Fernandez IS, Ralph SA, Cowman AF, Scheres SHW, Baum J: Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis. Nat Microbiol. 2017 Mar 13;2:17031. doi: 10.1038/nmicrobiol.2017.31. [Article]