Histone deacetylase 2

Details

Name
Histone deacetylase 2
Synonyms
  • 3.5.1.98
  • HD2
Gene Name
HDAC2
Organism
Human
Amino acid sequence
>lcl|BSEQ0004647|Histone deacetylase 2
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Number of residues
488
Molecular Weight
55363.855
Theoretical pI
5.75
GO Classification
Functions
deacetylase activity / core promoter binding / NAD-dependent histone deacetylase activity (H3-K14 specific) / NF-kappaB binding / poly(A) RNA binding / protein deacetylase activity / RNA polymerase II repressing transcription factor binding / chromatin binding / transcription factor binding / histone deacetylase activity / enzyme binding / sequence-specific DNA binding
Processes
positive regulation of transcription from RNA polymerase II promoter / cellular response to hydrogen peroxide / gene expression / negative regulation of gene expression, epigenetic / positive regulation of receptor biosynthetic process / positive regulation of cell proliferation / regulation of gene expression, epigenetic / positive regulation of proteolysis / positive regulation of collagen biosynthetic process / response to nicotine / blood coagulation / cellular response to dopamine / cellular response to heat / negative regulation of neuron projection development / positive regulation of tumor necrosis factor production / cellular response to retinoic acid / embryonic digit morphogenesis / negative regulation of DNA binding / response to amphetamine / response to caffeine / response to drug / cellular response to transforming growth factor beta stimulus / fungiform papilla formation / response to lipopolysaccharide / negative regulation of sequence-specific DNA binding transcription factor activity / ATP-dependent chromatin remodeling / dendrite development / positive regulation of epithelial to mesenchymal transition / hair follicle placode formation / negative regulation of transcription from RNA polymerase II promoter / negative regulation of transcription, DNA-templated / chromatin remodeling / maintenance of chromatin silencing / positive regulation of transcription, DNA-templated / cardiac muscle hypertrophy / response to cocaine / positive regulation of tyrosine phosphorylation of Stat3 protein / epidermal cell differentiation / negative regulation of peptidyl-lysine acetylation / response to hyperoxia / negative regulation of MHC class II biosynthetic process / positive regulation of oligodendrocyte differentiation / histone deacetylation / behavioral response to ethanol / eyelid development in camera-type eye / negative regulation of dendritic spine development / negative regulation of apoptotic process / chromatin organization / odontogenesis of dentin-containing tooth / negative regulation of cell cycle / histone H3 deacetylation / positive regulation of interleukin-1 production / neurotrophin TRK receptor signaling pathway / transcription, DNA-templated / circadian regulation of gene expression / histone H4 deacetylation
Components
Sin3 complex / cytoplasm / protein complex / nuclear chromatin / nucleoplasm / nucleus / ESC/E(Z) complex / NuRD complex
General Function
Transcription factor binding
Specific Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0016767|Histone deacetylase 2 (HDAC2)
ATGGCGTACAGTCAAGGAGGCGGCAAAAAAAAAGTCTGCTACTACTACGACGGTGATATT
GGAAATTATTATTATGGACAGGGTCATCCCATGAAGCCTCATAGAATCCGCATGACCCAT
AACTTGCTGTTAAATTATGGCTTATACAGAAAAATGGAAATATATAGGCCCCATAAAGCC
ACTGCCGAAGAAATGACAAAATATCACAGTGATGAGTATATCAAATTTCTACGGTCAATA
AGACCAGATAACATGTCTGAGTATAGTAAGCAGATGCAGAGATTTAATGTTGGAGAAGAT
TGTCCAGTGTTTGATGGACTCTTTGAGTTTTGTCAGCTCTCAACTGGCGGTTCAGTTGCT
GGAGCTGTGAAGTTAAACCGACAACAGACTGATATGGCTGTTAATTGGGCTGGAGGATTA
CATCATGCTAAGAAATCAGAAGCATCAGGATTCTGTTACGTTAATGATATTGTGCTTGCC
ATCCTTGAATTACTAAAGTATCATCAGAGAGTCTTATATATTGATATAGATATTCATCAT
GGTGATGGTGTTGAAGAAGCTTTTTATACAACAGATCGTGTAATGACGGTATCATTCCAT
AAATATGGGGAATACTTTCCTGGCACAGGAGACTTGAGGGATATTGGTGCTGGAAAAGGC
AAATACTATGCTGTCAATTTTCCAATGAGAGATGGTATAGATGATGAGTCATATGGGCAG
ATATTTAAGCCTATTATCTCAAAGGTGATGGAGATGTATCAACCTAGTGCTGTGGTATTA
CAGTGTGGTGCAGACTCATTATCTGGTGATAGACTGGGTTGTTTCAATCTAACAGTCAAA
GGTCATGCTAAATGTGTAGAAGTTGTAAAAACTTTTAACTTACCATTACTGATGCTTGGA
GGAGGTGGCTACACAATCCGTAATGTTGCTCGATGTTGGACATATGAGACTGCAGTTGCC
CTTGATTGTGAGATTCCCAATGAGTTGCCATATAATGATTACTTTGAGTATTTTGGACCA
GACTTCAAACTGCATATTAGTCCTTCAAACATGACAAACCAGAACACTCCAGAATATATG
GAAAAGATAAAACAGCGTTTGTTTGAAAATTTGCGCATGTTACCTCATGCACCTGGTGTC
CAGATGCAAGCTATTCCAGAAGATGCTGTTCATGAAGACAGTGGAGATGAAGATGGAGAA
GATCCAGACAAGAGAATTTCTATTCGAGCATCAGACAAGCGGATAGCTTGTGATGAAGAA
TTCTCAGATTCTGAGGATGAAGGAGAAGGAGGTCGAAGAAATGTGGCTGATCATAAGAAA
GGAGCAAAGAAAGCTAGAATTGAAGAAGATAAGAAAGAAACAGAGGACAAAAAAACAGAC
GTTAAGGAAGAAGATAAATCCAAGGACAACAGTGGTGAAAAAACAGATACCAAAGGAACC
AAATCAGAACAGCTCAGCAACCCCTGA
Chromosome Location
6
Locus
6q21
External Identifiers
ResourceLink
UniProtKB IDQ92769
UniProtKB Entry NameHDAC2_HUMAN
GenBank Protein ID1667394
GenBank Gene IDU31814
GenAtlas IDHDAC2
HGNC IDHGNC:4853
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02546Vorinostatapproved, investigationalyesinhibitorDetails
DB05223PracinostatinvestigationalunknownDetails
DB11830MocetinostatinvestigationalunknownDetails
DB00227Lovastatinapproved, investigationalnootherDetails
DB01303OxtriphyllineapprovedyesactivatorDetails
DB00277TheophyllineapprovedyesactivatorDetails
DB01223AminophyllineapprovedyesactivatorDetails
DB00313Valproic Acidapproved, investigationalunknowninhibitorDetails
DB06176Romidepsinapproved, investigationalyesantagonistinhibitorDetails
DB09091Tixocortolapproved, withdrawnyesstimulatorDetails
DB05015Belinostatapproved, investigationalyesinhibitorDetails
DB06603Panobinostatapproved, investigationalyesinhibitorDetails