Trace amine-associated receptor 1

Details

Name
Trace amine-associated receptor 1
Synonyms
  • TA1
  • TaR-1
  • TAR1
  • TRAR1
Gene Name
TAAR1
Organism
Human
Amino acid sequence
>lcl|BSEQ0010729|Trace amine-associated receptor 1
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Number of residues
339
Molecular Weight
39091.34
Theoretical pI
8.82
GO Classification
Functions
G-protein coupled receptor activity / trace-amine receptor activity
Processes
G-protein coupled receptor signaling pathway / sensory perception of chemical stimulus / positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway / cAMP biosynthetic process
Components
plasma membrane / integral component of membrane / integral component of plasma membrane
General Function
Trace-amine receptor activity
Specific Function
Receptor for trace amines, including beta-phenylethylamine (b-PEA), p-tyramine (p-TYR), octopamine and tryptamine, with highest affinity for b-PEA and p-TYR. Unresponsive to classical biogenic amines, such as epinephrine and histamine and only partially activated by dopamine and serotonine. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood. The signal transduced by this receptor is mediated by the G(s)-class of G-proteins which activate adenylate cyclase.
Pfam Domain Function
Transmembrane Regions
26-46 60-80 99-119 137-157 189-209 253-273 288-308
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010730|Trace amine-associated receptor 1 (TAAR1)
ATGATGCCCTTTTGCCACAATATAATTAATATTTCCTGTGTGAAAAACAACTGGTCAAAT
GATGTCCGTGCTTCCCTGTACAGTTTAATGGTGCTCATAATTCTGACCACACTCGTTGGC
AATCTGATAGTTATTGTTTCTATATCACACTTCAAACAACTTCATACCCCAACAAATTGG
CTCATTCATTCCATGGCCACTGTGGACTTTCTTCTGGGGTGTCTGGTCATGCCTTACAGT
ATGGTGAGATCTGCTGAGCACTGTTGGTATTTTGGAGAAGTCTTCTGTAAAATTCACACA
AGCACCGACATTATGCTGAGCTCAGCCTCCATTTTCCATTTGTCTTTCATCTCCATTGAC
CGCTACTATGCTGTGTGTGATCCACTGAGATATAAAGCCAAGATGAATATCTTGGTTATT
TGTGTGATGATCTTCATTAGTTGGAGTGTCCCTGCTGTTTTTGCATTTGGAATGATCTTT
CTGGAGCTAAACTTCAAAGGCGCTGAAGAGATATATTACAAACATGTTCACTGCAGAGGA
GGTTGCTCTGTCTTCTTTAGCAAAATATCTGGGGTACTGACCTTTATGACTTCTTTTTAT
ATACCTGGATCTATTATGTTATGTGTCTATTACAGAATATATCTTATCGCTAAAGAACAG
GCAAGATTAATTAGTGATGCCAATCAGAAGCTCCAAATTGGATTGGAAATGAAAAATGGA
ATTTCACAAAGCAAAGAAAGGAAAGCTGTGAAGACATTGGGGATTGTGATGGGAGTTTTC
CTAATATGCTGGTGCCCTTTCTTTATCTGTACAGTCATGGACCCTTTTCTTCACTACATT
ATTCCACCTACTTTGAATGATGTATTGATTTGGTTTGGCTACTTGAACTCTACATTTAAT
CCAATGGTTTATGCATTTTTCTATCCTTGGTTTAGAAAAGCACTGAAGATGATGCTGTTT
GGTAAAATTTTCCAAAAAGATTCATCCAGGTGTAAATTATTTTTGGAATTGAGTTCATAG
Chromosome Location
6
Locus
6q23.2
External Identifiers
ResourceLink
UniProtKB IDQ96RJ0
UniProtKB Entry NameTAAR1_HUMAN
GenBank Protein ID14600074
GenBank Gene IDAF380185
GenAtlas IDTAAR1
HGNC IDHGNC:17734
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00182Amphetamineapproved, illicit, investigationalyesagonistDetails
DB06714PropylhexedrineapprovedunknownagonistDetails
DB01576Dextroamphetamineapproved, illicitunknownagonistDetails
DB01577Metamfetamineapproved, illicityesagonistDetails