Solute carrier family 22 member 4

Details

Name
Solute carrier family 22 member 4
Synonyms
  • Ergothioneine transporter
  • ET transporter
  • ETT
  • OCTN1
  • Organic cation/carnitine transporter 1
  • UT2H
Gene Name
SLC22A4
Organism
Human
Amino acid sequence
>lcl|BSEQ0010533|Solute carrier family 22 member 4
MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSS
AWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQ
TGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFA
VGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKA
AKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALS
LDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV
DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVY
LGAYNRMLPYIVMGSLTVLIGILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMET
EENPKVLITAF
Number of residues
551
Molecular Weight
62154.48
Theoretical pI
7.27
GO Classification
Functions
nucleotide binding / quaternary ammonium group transmembrane transporter activity / symporter activity / ATP binding / secondary active organic cation transmembrane transporter activity / carnitine transmembrane transporter activity / cation / PDZ domain binding
Processes
triglyceride metabolic process / carnitine metabolic process / sodium ion transport / carnitine transmembrane transport / carnitine transport / modified amino acid transport / transmembrane transport / quaternary ammonium group transport / body fluid secretion / organic cation transport
Components
mitochondrion / plasma membrane / integral component of plasma membrane / apical plasma membrane
General Function
Symporter activity
Specific Function
Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78. A key substrate of this transporter seems to be ergothioneine (ET).
Pfam Domain Function
Transmembrane Regions
21-41 142-162 172-192 198-218 233-253 258-278 338-358 372-392 400-420 427-447 461-481 487-507
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010534|Solute carrier family 22 member 4 (SLC22A4)
ATGCGGGACTACGACGAGGTGATCGCCTTCCTGGGCGAGTGGGGGCCCTTCCAGCGCCTC
ATCTTCTTCCTGCTCAGCGCCAGCATCATCCCCAATGGCTTCAATGGTATGTCAGTCGTG
TTCCTGGCGGGGACCCCGGAGCACCGCTGTCGAGTGCCGGACGCCGCGAACCTGAGCAGC
GCCTGGCGCAACAACAGTGTCCCGCTGCGGCTGCGGGACGGCCGCGAGGTGCCCCACAGC
TGCAGCCGCTACCGGCTCGCCACCATCGCCAACTTCTCGGCGCTCGGGCTGGAGCCGGGG
CGCGACGTGGACCTGGGGCAGCTGGAGCAGGAGAGCTGCCTGGATGGCTGGGAGTTCAGC
CAGGACGTCTACCTGTCCACCGTCGTGACCGAGTGGAATCTGGTGTGTGAGGACAACTGG
AAGGTGCCCCTCACCACCTCCCTGTTCTTCGTAGGCGTGCTCCTCGGCTCCTTCGTGTCC
GGGCAGCTGTCAGACAGGTTTGGCAGGAAGAACGTTCTCTTCGCAACCATGGCTGTACAG
ACTGGCTTCAGCTTCCTGCAGATTTTCTCCATCAGCTGGGAGATGTTCACTGTGTTATTT
GTCATCGTGGGCATGGGCCAGATCTCCAACTATGTGGTAGCCTTCATACTAGGAACAGAA
ATTCTTGGCAAGTCAGTTCGTATTATATTCTCTACATTAGGAGTGTGCACATTTTTTGCA
GTTGGCTATATGCTGCTGCCACTGTTTGCTTACTTCATCAGAGACTGGCGGATGCTGCTG
CTGGCGCTGACGGTGCCGGGAGTGCTGTGTGTCCCGCTGTGGTGGTTCATTCCTGAATCT
CCCCGATGGCTGATATCCCAGAGAAGATTTAGAGAGGCTGAAGATATCATCCAAAAAGCT
GCAAAAATGAACAACATAGCTGTACCAGCAGTGATATTTGATTCTGTGGAGGAGCTAAAT
CCCCTGAAGCAGCAGAAAGCTTTCATTCTGGACCTGTTCAGGACTCGGAATATTGCCATA
ATGACCATTATGTCTTTGCTGCTATGGATGCTGACCTCAGTGGGTTACTTTGCTCTGTCT
CTGGATGCTCCTAATTTACATGGAGATGCCTACCTGAACTGTTTCCTCTCTGCCTTGATT
GAAATTCCAGCTTACATTACAGCCTGGCTGCTATTGCGAACCCTGCCCAGGCGTTATATC
ATAGCTGCAGTACTGTTCTGGGGAGGAGGTGTGCTTCTCTTCATTCAACTGGTACCTGTG
GATTATTACTTCTTATCCATTGGTCTGGTCATGCTGGGAAAATTTGGGATCACCTCTGCT
TTCTCCATGCTGTATGTCTTCACTGCTGAGCTCTACCCAACCCTGGTCAGGAACATGGCG
GTGGGGGTCACATCCACGGCCTCCAGAGTGGGCAGCATCATTGCCCCCTACTTTGTTTAC
CTCGGTGCTTACAACAGAATGCTGCCCTACATCGTCATGGGTAGTCTGACTGTCCTGATT
GGAATCCTCACCCTTTTTTTCCCTGAAAGTTTGGGAATGACTCTTCCAGAAACCTTAGAG
CAGATGCAGAAAGTGAAATGGTTCAGATCTGGGAAAAAAACAAGAGACTCAATGGAGACA
GAAGAAAATCCCAAGGTTCTAATAACTGCATTCTGA
Chromosome Location
5
Locus
5q31.1
External Identifiers
ResourceLink
UniProtKB IDQ9H015
UniProtKB Entry NameS22A4_HUMAN
GenBank Protein ID2605501
GenBank Gene IDAB007448
GenAtlas IDSLC22A4
HGNC IDHGNC:10968
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00583L-Carnitineapproved, investigationalunknownDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00127Spermineapproved, nutraceuticalunknowninhibitorDetails
DB03566SpermidineexperimentalunknowninhibitorDetails
DB00468QuinineapprovedunknowninhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB01917PutrescineexperimentalunknowninhibitorDetails
DB01035ProcainamideapprovedunknowninhibitorDetails
DB01053Benzylpenicillinapproved, vet_approvedunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB01165OfloxacinapprovedunknowninhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB00123L-Lysineapproved, nutraceuticalunknowninhibitorDetails
DB01137Levofloxacinapproved, investigationalunknowninhibitorDetails
DB00536GuanidineapprovedunknowninhibitorDetails
DB00575ClonidineapprovedunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB00122Cholineapproved, nutraceuticalunknowninhibitorDetails
DB00583L-Carnitineapproved, investigationalunknownsubstrateinhibitorDetails
DB00125L-Arginineapproved, nutraceuticalunknowninhibitorDetails
DB00594AmilorideapprovedunknowninhibitorDetails
DB00458ImipramineapprovedunknowninhibitorDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB00332IpratropiumapprovedunknownsubstrateDetails
DB01409TiotropiumapprovedunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB08837Tetraethylammoniumexperimental, investigationalunknownDetails
DB06691Mepyramineapproved, vet_approvedunknownDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB14006Choline salicylateapproved, nutraceuticalunknowninhibitorDetails