Chloroquine resistance transporter
Details
- Name
- Chloroquine resistance transporter
- Synonyms
- PfCRT
- Gene Name
- CRT
- Organism
- Plasmodium falciparum
- Amino acid sequence
>lcl|BSEQ0051423|Chloroquine resistance transporter MKFASKKNNQKNSSKNDERYRELDNLVQEGNGSRLGGGSCLGKCAHVFKLIFKEIKDNIF IYILSIIYLSVCVMNKIFAKRTLNKIGNYSFVTSETHNFICMIMFFIVYSLFGNKKGNSK ERHRSFNLQFFAISMLDACSVILAFIGLTRTTGNIQSFVLQLSIPINMFFCFLILRYRYH LYNYLGAVIIVVTIALVEMKLSFETQEENSIIFNLVLISALIPVCFSNMTREIVFKKYKI DILRLNAMVSFFQLFTSCLILPVYTLPFLKQLHLPYNEIWTNIKNGFACLFLGRNTVVEN CGLGMAKLCDDCDGAWKTFALFSFFNICDNLITSYIIDKFSTMTYTIVSCIQGPAIAIAY YFKFLAGDVVREPRLLDFVTLFGYLFGSIIYRVGNIILERKKMRNEENEDSEGELTNVDS IITQ
- Number of residues
- 424
- Molecular Weight
- 48674.705
- Theoretical pI
- Not Available
- GO Classification
- Functionsdrug transmembrane transporter activityComponentsintegral component of membrane / vacuolar membrane
- General Function
- May regulate endogenous transporter.
- Specific Function
- Drug transmembrane transporter activity
- Pfam Domain Function
- CRT-like (PF08627)
- Transmembrane Regions
- 59-79 91-111 128-148 155-175 179-199 210-230 249-269 318-338 347-367 378-398
- Cellular Location
- Vacuole membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9N623 UniProtKB Entry Name CRT_PLAFA - General References
- Fidock DA, Nomura T, Talley AK, Cooper RA, Dzekunov SM, Ferdig MT, Ursos LM, Sidhu AB, Naude B, Deitsch KW, Su XZ, Wootton JC, Roepe PD, Wellems TE: Mutations in the P. falciparum digestive vacuole transmembrane protein PfCRT and evidence for their role in chloroquine resistance. Mol Cell. 2000 Oct;6(4):861-71. [Article]
- Johnson DJ, Fidock DA, Mungthin M, Lakshmanan V, Sidhu AB, Bray PG, Ward SA: Evidence for a central role for PfCRT in conferring Plasmodium falciparum resistance to diverse antimalarial agents. Mol Cell. 2004 Sep 24;15(6):867-77. doi: 10.1016/j.molcel.2004.09.012. [Article]
- Echeverry DF, Holmgren G, Murillo C, Higuita JC, Bjorkman A, Gil JP, Osorio L: Short report: polymorphisms in the pfcrt and pfmdr1 genes of Plasmodium falciparum and in vitro susceptibility to amodiaquine and desethylamodiaquine. Am J Trop Med Hyg. 2007 Dec;77(6):1034-8. [Article]
- Chen N, Kyle DE, Pasay C, Fowler EV, Baker J, Peters JM, Cheng Q: pfcrt Allelic types with two novel amino acid mutations in chloroquine-resistant Plasmodium falciparum isolates from the Philippines. Antimicrob Agents Chemother. 2003 Nov;47(11):3500-5. [Article]
- Nessler S, Friedrich O, Bakouh N, Fink RH, Sanchez CP, Planelles G, Lanzer M: Evidence for activation of endogenous transporters in Xenopus laevis oocytes expressing the Plasmodium falciparum chloroquine resistance transporter, PfCRT. J Biol Chem. 2004 Sep 17;279(38):39438-46. doi: 10.1074/jbc.M404671200. Epub 2004 Jul 16. [Article]
- Cooper RA, Ferdig MT, Su XZ, Ursos LM, Mu J, Nomura T, Fujioka H, Fidock DA, Roepe PD, Wellems TE: Alternative mutations at position 76 of the vacuolar transmembrane protein PfCRT are associated with chloroquine resistance and unique stereospecific quinine and quinidine responses in Plasmodium falciparum. Mol Pharmacol. 2002 Jan;61(1):35-42. [Article]
- Cooper RA, Lane KD, Deng B, Mu J, Patel JJ, Wellems TE, Su X, Ferdig MT: Mutations in transmembrane domains 1, 4 and 9 of the Plasmodium falciparum chloroquine resistance transporter alter susceptibility to chloroquine, quinine and quinidine. Mol Microbiol. 2007 Jan;63(1):270-82. doi: 10.1111/j.1365-2958.2006.05511.x. Epub 2006 Dec 5. [Article]