Histone deacetylase 6

Details

Name
Histone deacetylase 6
Synonyms
  • 3.5.1.98
  • HD6
  • KIAA0901
Gene Name
HDAC6
Organism
Human
Amino acid sequence
>lcl|BSEQ0037198|Histone deacetylase 6
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
Number of residues
1215
Molecular Weight
131418.19
Theoretical pI
4.98
GO Classification
Functions
tubulin deacetylase activity / zinc ion binding / core promoter binding / dynein complex binding / histone deacetylase binding / NAD-dependent histone deacetylase activity (H3-K14 specific) / microtubule binding / polyubiquitin binding / alpha-tubulin binding / histone deacetylase activity / misfolded protein binding / ubiquitin protein ligase binding / beta-catenin binding / tau protein binding / Hsp90 protein binding / enzyme binding
Processes
macroautophagy / cellular response to heat / tubulin deacetylation / cellular response to hydrogen peroxide / peptidyl-lysine deacetylation / regulation of protein stability / mitochondrion localization / cellular response to misfolded protein / positive regulation of epithelial cell migration / negative regulation of proteolysis / cellular response to topologically incorrect protein / negative regulation of transcription, DNA-templated / regulation of androgen receptor signaling pathway / protein complex disassembly / positive regulation of receptor biosynthetic process / Hsp90 deacetylation / mitophagy in response to mitochondrial depolarization / intracellular protein transport / protein deacetylation / lysosome localization / regulation of fat cell differentiation / aggresome assembly / negative regulation of microtubule depolymerization / response to toxic substance / response to growth factor / polyubiquitinated misfolded protein transport / response to organic substance / positive regulation of signal transduction / positive regulation of chaperone-mediated protein complex assembly / protein polyubiquitination / histone deacetylation / response to misfolded protein / organelle organization / regulation of microtubule-based movement / positive regulation of hydrogen peroxide-mediated programmed cell death / negative regulation of hydrogen peroxide metabolic process / regulation of receptor activity / misfolded or incompletely synthesized protein catabolic process / regulation of establishment of protein localization / regulation of gene expression, epigenetic / negative regulation of oxidoreductase activity / transcription, DNA-templated / ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway / negative regulation of protein complex disassembly
Components
perinuclear region of cytoplasm / cytoplasm / dendrite / axon / inclusion body / microtubule / nucleus / perikaryon / caveola / cytoplasmic microtubule / microtubule associated complex / aggresome / cell leading edge / cytosol / histone deacetylase complex
General Function
Zinc ion binding
Specific Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0021857|Histone deacetylase 6 (HDAC6)
ATGACCTCAACCGGCCAGGATTCCACCACAACCAGGCAGCGAAGAAGTAGGCAGAACCCC
CAGTCGCCCCCTCAGGACTCCAGTGTCACTTCGAAGCGAAATATTAAAAAGGGAGCCGTT
CCCCGCTCTATCCCCAATCTAGCGGAGGTAAAGAAGAAAGGCAAAATGAAGAAGCTCGGC
CAAGCAATGGAAGAAGACCTAATCGTGGGACTGCAAGGGATGGATCTGAACCTTGAGGCT
GAAGCACTGGCTGGCACTGGCTTGGTGTTGGATGAGCAGTTAAATGAATTCCATTGCCTC
TGGGATGACAGCTTCCCGGAAGGCCCTGAGCGGCTCCATGCCATCAAGGAGCAACTGATC
CAGGAGGGCCTCCTAGATCGCTGCGTGTCCTTTCAGGCCCGGTTTGCTGAAAAGGAAGAG
CTGATGTTGGTTCACAGCCTAGAATATATTGATCTGATGGAAACAACCCAGTACATGAAT
GAGGGAGAACTCCGTGTCCTAGCAGACACCTACGACTCAGTTTATCTGCATCCGAACTCA
TACTCCTGTGCCTGCCTGGCCTCAGGCTCTGTCCTCAGGCTGGTGGATGCGGTCCTGGGG
GCTGAGATCCGGAATGGCATGGCCATCATTAGGCCTCCTGGACATCACGCCCAGCACAGT
CTTATGGATGGCTATTGCATGTTCAACCACGTGGCTGTGGCAGCCCGCTATGCTCAACAG
AAACACCGCATCCGGAGGGTCCTTATCGTAGATTGGGATGTGCACCACGGTCAAGGAACA
CAGTTCACCTTCGACCAGGACCCCAGTGTCCTCTATTTCTCCATCCACCGCTACGAGCAG
GGTAGGTTCTGGCCCCACCTGAAGGCCTCTAACTGGTCCACCACAGGTTTCGGCCAAGGC
CAAGGATATACCATCAATGTGCCTTGGAACCAGGTGGGGATGCGGGATGCTGACTACATT
GCTGCTTTCCTGCACGTCCTGCTGCCAGTCGCCCTCGAGTTCCAGCCTCAGCTGGTCCTG
GTGGCTGCTGGATTTGATGCCCTGCAAGGGGACCCCAAGGGTGAGATGGCCGCCACTCCG
GCAGGGTTCGCCCAGCTAACCCACCTGCTCATGGGTCTGGCAGGAGGCAAGCTGATCCTG
TCTCTGGAGGGTGGCTACAACCTCCGCGCCCTGGCTGAAGGCGTCAGTGCTTCGCTCCAC
ACCCTTCTGGGAGACCCTTGCCCCATGCTGGAGTCACCTGGTGCCCCCTGCCGGAGTGCC
CAGGCTTCAGTTTCCTGTGCTCTGGAAGCCCTTGAGCCCTTCTGGGAGGTTCTTGTGAGA
TCAACTGAGACCGTGGAGAGGGACAACATGGAGGAGGACAATGTAGAGGAGAGCGAGGAG
GAAGGACCCTGGGAGCCCCCTGTGCTCCCAATCCTGACATGGCCAGTGCTACAGTCTCGC
ACAGGGCTGGTCTATGACCAAAATATGATGAATCACTGCAACTTGTGGGACAGCCACCAC
CCTGAGGTACCCCAGCGCATCTTGCGGATCATGTGCCGTCTGGAGGAGCTGGGCCTTGCC
GGGCGCTGCCTCACCCTGACACCGCGCCCTGCCACAGAGGCTGAGCTGCTCACCTGTCAC
AGTGCTGAGTACGTGGGTCATCTCCGGGCCACAGAGAAAATGAAAACCCGGGAGCTGCAC
CGTGAGAGTTCCAACTTTGACTCCATCTATATCTGCCCCAGTACCTTCGCCTGTGCACAG
CTTGCCACTGGCGCTGCCTGCCGCCTGGTGGAGGCTGTGCTCTCAGGAGAGGTTCTGAAT
GGTGCTGCTGTGGTGCGTCCCCCAGGACACCACGCAGAGCAGGATGCAGCTTGCGGTTTT
TGCTTTTTCAACTCTGTGGCTGTGGCTGCTCGCCATGCCCAGACTATCAGTGGGCATGCC
CTACGGATCCTGATTGTGGATTGGGATGTCCACCACGGTAATGGAACTCAGCACATGTTT
GAGGATGACCCCAGTGTGCTATATGTGTCCCTGCACCGCTATGATCATGGCACCTTCTTC
CCCATGGGGGATGAGGGTGCCAGCAGCCAGATCGGCCGGGCTGCGGGCACAGGCTTCACC
GTCAACGTGGCATGGAACGGGCCCCGCATGGGTGATGCTGACTACCTAGCTGCCTGGCAT
CGCCTGGTGCTTCCCATTGCCTACGAGTTTAACCCAGAACTGGTGCTGGTCTCAGCTGGC
TTTGATGCTGCACGGGGGGATCCGCTGGGGGGCTGCCAGGTGTCACCTGAGGGTTATGCC
CACCTCACCCACCTGCTGATGGGCCTTGCCAGTGGCCGCATTATCCTTATCCTAGAGGGT
GGCTATAACCTGACATCCATCTCAGAGTCCATGGCTGCCTGCACTCGCTCCCTCCTTGGA
GACCCACCACCCCTGCTGACCCTGCCACGGCCCCCACTATCAGGGGCCCTGGCCTCAATC
ACTGAGACCATCCAAGTCCATCGCAGATACTGGCGCAGCTTACGGGTCATGAAGGTAGAA
GACAGAGAAGGACCCTCCAGTTCTAAGTTGGTCACCAAGAAGGCACCCCAACCAGCCAAA
CCTAGGTTAGCTGAGCGGATGACCACACGAGAAAAGAAGGTTCTGGAAGCAGGCATGGGG
AAAGTCACCTCGGCATCATTTGGGGAAGAGTCCACTCCAGGCCAGACTAACTCAGAGACA
GCTGTGGTGGCCCTCACTCAGGACCAGCCCTCAGAGGCAGCCACAGGGGGAGCCACTCTG
GCCCAGACCATTTCTGAGGCAGCCATTGGGGGAGCCATGCTGGGCCAGACCACCTCAGAG
GAGGCTGTCGGGGGAGCCACTCCGGACCAGACCACCTCAGAGGAGACTGTGGGAGGAGCC
ATTCTGGACCAGACCACCTCAGAGGATGCTGTTGGGGGAGCCACGCTGGGCCAGACTACC
TCAGAGGAGGCTGTAGGAGGAGCTACACTGGCCCAGACCACCTCGGAGGCAGCCATGGAG
GGAGCCACACTGGACCAGACTACGTCAGAGGAGGCTCCAGGGGGCACCGAGCTGATCCAA
ACTCCTCTAGCCTCGAGCACAGACCACCAGACCCCCCCAACCTCACCTGTGCAGGGAACT
ACACCCCAGATATCTCCCAGTACACTGATTGGGAGTCTCAGGACCTTGGAGCTAGGCAGC
GAATCTCAGGGGGCCTCAGAATCTCAGGCCCCAGGAGAGGAGAACCTACTAGGAGAGGCA
GCTGGAGGTCAGGACATGGCTGATTCGATGCTGATGCAGGGATCTAGGGGCCTCACTGAT
CAGGCCATATTTTATGCTGTGACACCACTGCCCTGGTGTCCCCATTTGGTGGCAGTATGC
CCCATACCTGCAGCAGGCCTAGACGTGACCCAACCTTGTGGGGACTGTGGAACAATCCAA
GAGAATTGGGTGTGTCTCTCTTGCTATCAGGTCTACTGTGGTCGTTACATCAATGGCCAC
ATGCTCCAACACCATGGAAATTCTGGACACCCGCTGGTCCTCAGCTACATCGACCTGTCA
GCCTGGTGTTACTACTGTCAGGCCTATGTCCACCACCAGGCTCTCCTAGATGTGAAGAAC
ATCGCCCACCAGAACAAGTTTGGGGAGGATATGCCCCACCCACACTAA
Chromosome Location
X
Locus
Xp11.23
External Identifiers
ResourceLink
UniProtKB IDQ9UBN7
UniProtKB Entry NameHDAC6_HUMAN
GenBank Protein ID4754911
GenBank Gene IDAF132609
GenAtlas IDHDAC6
HGNC IDHGNC:14064
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02546Vorinostatapproved, investigationalyesinhibitorDetails
DB05223PracinostatinvestigationalunknownDetails
DB06176Romidepsinapproved, investigationalnoinhibitorDetails
DB13346Bufexamacapproved, experimentalunknowninhibitorDetails
DB05015Belinostatapproved, investigationalyesinhibitorDetails
DB06603Panobinostatapproved, investigationalyesinhibitorDetails