Gamma-aminobutyric acid receptor subunit theta

Details

Name
Gamma-aminobutyric acid receptor subunit theta
Synonyms
  • GABA(A) receptor subunit theta
Gene Name
GABRQ
Organism
Human
Amino acid sequence
>lcl|BSEQ0012499|Gamma-aminobutyric acid receptor subunit theta
MGIRGMLRAAVILLLIRTWLAEGNYPSPIPKFHFEFSSAVPEVVLNLFNCKNCANEAVVQ
KILDRVLSRYDVRLRPNFGGAPVPVRISIYVTSIEQISEMNMDYTITMFFHQTWKDSRLA
YYETTLNLTLDYRMHEKLWVPDCYFLNSKDAFVHDVTVENRVFQLHPDGTVRYGIRLTTT
AACSLDLHKFPMDKQACNLVVESYGYTVEDIILFWDDNGNAIHMTEELHIPQFTFLGRTI
TSKEVYFYTGSYIRLILKFQVQREVNSYLVQVYWPTVLTTITSWISFWMNYDSSAARVTI
GLTSMLILTTIDSHLRDKLPNISCIKAIDIYILVCLFFVFLSLLEYVYINYLFYSRGPRR
QPRRHRRPRRVIARYRYQQVVVGNVQDGLINVEDGVSSLPITPAQAPLASPESLGSLTST
SEQAQLATSESLSPLTSLSGQAPLATGESLSDLPSTSEQARHSYGVRFNGFQADDSIFPT
EIRNRVEAHGHGVTHDHEDSNESLSSDERHGHGPSGKPMLHHGEKGVQEAGWDLDDNNDK
SDCLAIKEQFKCDTNSTWGLNDDELMAHGQEKDSSSESEDSCPPSPGCSFTEGFSFDLFN
PDYVPKVDKWSRFLFPLAFGLFNIVYWVYHMY
Number of residues
632
Molecular Weight
72020.875
Theoretical pI
5.76
GO Classification
Functions
extracellular ligand-gated ion channel activity / chloride channel activity / GABA-A receptor activity / neurotransmitter transporter activity / transmembrane signaling receptor activity
Processes
signal transduction / transmembrane transport / ion transmembrane transport / chloride transmembrane transport / neurotransmitter transport / regulation of membrane potential / neurological system process / synaptic transmission
Components
GABA-A receptor complex / integral component of plasma membrane / postsynaptic membrane / synapse / neuron projection / plasma membrane / receptor complex / chloride channel complex / cell junction
General Function
Transmembrane signaling receptor activity
Specific Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions
269-289 327-347 612-632
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0012500|Gamma-aminobutyric acid receptor subunit theta (GABRQ)
ATGGGCATCCGAGGCATGCTGCGAGCCGCAGTGATCCTGCTGCTCATCAGGACCTGGCTC
GCGGAGGGCAACTACCCCAGTCCCATCCCGAAATTCCACTTCGAGTTCTCCTCTGCTGTG
CCCGAAGTCGTCCTGAACCTCTTCAACTGCAAAAATTGTGCAAATGAAGCTGTGGTTCAA
AAGATTTTGGACAGGGTGCTGTCAAGATACGATGTCCGCCTGAGACCGAATTTTGGAGGT
GCCCCTGTGCCTGTGAGAATATCTATTTATGTCACGAGCATTGAACAGATCTCAGAAATG
AATATGGACTACACGATCACGATGTTTTTTCATCAGACTTGGAAAGATTCACGCTTAGCA
TACTATGAGACCACCCTGAACTTGACCCTGGACTATCGGATGCATGAGAAGTTGTGGGTC
CCTGACTGCTACTTTCTGAACAGCAAGGATGCTTTCGTGCATGATGTGACTGTGGAGAAT
CGCGTGTTTCAGCTTCACCCAGATGGAACGGTGCGGTACGGCATCCGACTCACCACTACA
GCAGCTTGTTCCCTGGATCTGCATAAATTCCCTATGGACAAGCAGGCCTGCAACCTGGTG
GTAGAGAGCTATGGTTACACGGTTGAAGACATCATATTATTCTGGGATGACAATGGGAAC
GCCATCCACATGACTGAGGAGCTGCATATCCCTCAGTTCACTTTCCTGGGAAGGACGATT
ACTAGCAAGGAGGTGTATTTCTACACAGGTTCCTACATACGCCTGATACTGAAGTTCCAG
GTTCAGAGGGAAGTTAACAGCTACCTTGTGCAAGTCTACTGGCCTACTGTCCTCACCACT
ATTACCTCTTGGATATCGTTTTGGATGAACTATGATTCCTCTGCAGCCAGGGTGACAATT
GGCTTAACTTCAATGCTCATCCTGACCACCATCGACTCACATCTGCGGGATAAGCTCCCC
AACATTTCCTGTATCAAGGCCATTGATATCTATATCCTCGTGTGCTTGTTCTTTGTGTTC
CTGTCCTTGCTGGAGTATGTCTACATCAACTATCTTTTCTACAGTCGAGGACCTCGGCGC
CAGCCTAGGCGACACAGGAGACCCCGAAGAGTCATTGCCCGCTACCGCTACCAGCAAGTG
GTGGTAGGAAACGTGCAGGATGGCCTGATTAACGTGGAAGACGGAGTCAGCTCTCTCCCC
ATCACCCCAGCGCAGGCCCCCCTGGCAAGCCCGGAAAGCCTCGGTTCTTTGACGTCCACC
TCCGAGCAGGCCCAGCTGGCCACCTCGGAAAGCCTCAGCCCACTCACTTCTCTCTCAGGC
CAGGCCCCCCTGGCCACTGGAGAAAGCCTGAGCGATCTCCCCTCCACCTCAGAGCAGGCC
CGGCACAGCTATGGTGTTCGCTTTAATGGTTTCCAGGCTGATGACAGTATTATTCCTACC
GAAATCCGCAACCGTGTCGAAGCCCATGGCCATGGTGTTACCCATGACCATGAAGATTCC
AATGAGAGCTTGAGCTCGGATGAGCGCCATGGCCATGGCCCCAGTGGGAAGCCCATGCTT
CACCATGGCGAGAAGGGTGTGCAAGAAGCAGGCTGGGACCTTGATGACAACAATGACAAG
AGCGACTGCCTTGCCATTAAGGAGCAATTCAAGTGTGATACTAACAGTACCTGGGGCCTT
AATGATGATGAGCTCATGGCCCATGGCCAAGAGAAGGACAGTAGCTCAGAGTCTGAGGAT
AGTTGCCCCCCAAGCCCTGGGTGCTCCTTCACTGAAGGGTTCTCCTTCGATCTCTTTAAT
CCTGACTACGTCCCAAAGGTCGACAAGTGGTCCCGGTTCCTCTTCCCTCTGGCCTTTGGG
TTGTTCAACATTGTTTACTGGGTATACCATATGTATTAG
Chromosome Location
X
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9UN88
UniProtKB Entry NameGBRT_HUMAN
GenBank Protein ID7861736
GenBank Gene IDAF189259
HGNC IDHGNC:14454
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00690Flurazepamapproved, illicit, investigationalyespotentiatorDetails
DB00842OxazepamapprovedyespotentiatorDetails
DB00683Midazolamapproved, illicityespotentiatorDetails
DB00231Temazepamapproved, investigationalyespotentiatorDetails
DB01558Bromazepamapproved, illicit, investigationalyespotentiatorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedyespotentiatorDetails
DB01595NitrazepamapprovedyespotentiatorDetails
DB00897Triazolamapproved, investigationalyespotentiatorDetails
DB00898EthanolapprovedunknownDetails
DB01189Desfluraneapprovedyespositive allosteric modulatorDetails
DB00659Acamprosateapproved, investigationalyespositive modulatorDetails
DB00404Alprazolamapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00237Butabarbitalapproved, illicityespositive allosteric modulatorDetails
DB00475Chlordiazepoxideapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00349Clobazamapproved, illicityespositive allosteric modulatorDetails
DB01068Clonazepamapproved, illicityespositive allosteric modulatorDetails
DB00628Clorazepateapproved, illicityespositive allosteric modulatorDetails
DB00186Lorazepamapprovedyespositive allosteric modulatorDetails
DB00189Ethchlorvynolapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00228Enfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00231Temazepamapproved, investigationalyespositive allosteric modulatorDetails
DB00241Butalbitalapproved, illicityespositive allosteric modulatorDetails
DB00273Topiramateapprovedyespositive allosteric modulatorDetails
DB00292Etomidateapprovedyespositive allosteric modulatorDetails
DB00306Talbutalapproved, illicityespositive allosteric modulatorDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00371Meprobamateapproved, illicityespositive allosteric modulatorDetails
DB00402Eszopicloneapproved, investigationalyespositive allosteric modulatorDetails
DB00463Metharbitalwithdrawnyespositive allosteric modulatorDetails
DB00753Isofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00794Primidoneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00801Halazepamapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00818Propofolapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00842Oxazepamapprovedyespositive allosteric modulatorDetails
DB00897Triazolamapproved, investigationalyespositive allosteric modulatorDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB01107Methyprylonapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB01159Halothaneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01205Flumazenilapprovedyespositive allosteric modulatorDetails
DB01215Estazolamapproved, illicityespositive allosteric modulatorDetails
DB01236Sevofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01437Glutethimideapproved, illicityespositive allosteric modulatorDetails
DB01588Prazepamapproved, illicityespositive allosteric modulatorDetails
DB01589Quazepamapproved, illicityespositive allosteric modulatorDetails
DB00543AmoxapineapprovedunknownbinderDetails
DB00334Olanzapineapproved, investigationalunknowninhibitorDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownantagonistDetails
DB11582ThiocolchicosideexperimentalyesantagonistDetails
DB09118Stiripentolapprovedyesagonistpositive allosteric modulatorDetails
DB01956Taurineapproved, nutraceuticalyesagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11901Apalutamideapproved, investigationalunknownantagonistDetails