Interferon Alfa-2a, Recombinant

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
Interferon Alfa-2a, Recombinant
Accession Number
DB00034  (BTD00095, BTD00012, BIOD00095, BIOD00012, DB00037)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Interferons
Description

Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.

Protein structure
Db00034
Protein chemical formula
C860H1353N227O255S9
Protein average weight
19241.1 Da
Sequences
>DB00034 sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Download FASTA Format
Synonyms
  • Interferon alfa-2a
  • Interferon alfa-2a (recombinant)
  • Interferon alfa-2a, recombinant
  • Interferon alfa-2a,recombinant
  • Interferon alpha-2a
  • Interferon-alfa-2a
  • Recombinant human interferon alfa-2a
  • Recombinant human interferon-alfa-2a
  • rIFN-alpha-2a
  • SH-polypeptide-46
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Roferon A Soln Inj 6 MillionLiquidIntramuscular; SubcutaneousHoffmann La Roche1989-12-311997-08-26Canada
Roferon A Sterile Pws 18m Unit/vialPowder, for solutionIntramuscular; SubcutaneousHoffmann La Roche1991-12-311996-09-30Canada
Roferon A Sterile Pws 3m Unit/vialPowder, for solutionIntramuscular; SubcutaneousHoffmann La Roche1991-12-311996-09-30Canada
Roferon A Sterile Pws 9m Unit/vialPowder, for solutionIntramuscular; SubcutaneousHoffmann La Roche1991-12-311996-09-30Canada
Roferon-AInjection, solution33.3 ug/0.5mLSubcutaneousGenentech, Inc.1986-06-042008-10-31Us
Roferon-AInjection, solution22.2 ug/0.5mLSubcutaneousGenentech, Inc.1986-06-042008-10-31Us
Roferon-AInjection, solution11.1 ug/0.5mLSubcutaneousGenentech, Inc.1986-06-042008-10-31Us
Roferon-A Sol Inj 3million Iu/vialLiquidIntramuscular; SubcutaneousHoffmann La Roche1989-12-311997-08-25Canada
Roferon-A Soln-liq Im Sc 4.5million I.u/mlLiquidIntramuscular; SubcutaneousHoffmann La Roche1997-04-251999-11-02Canada
Roferon-A Soln-liq Im Sc 9million I.U./mlSolutionIntramuscular; SubcutaneousHoffmann La Roche1997-04-292004-11-01Canada
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
International/Other Brands
Roferon A (Hoffmann-La Roche Inc) / Veldona (Amarillo Biosciences)
Categories
UNII
47RRR83SK7
CAS number
76543-88-9

Pharmacology

Indication

For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.

Pharmacodynamics

Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.

Mechanism of action

Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.

TargetActionsOrganism
AInterferon alpha/beta receptor 1Not AvailableHumans
AInterferon alpha/beta receptor 2Not AvailableHumans
Absorption

Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.

Volume of distribution
  • 0.223 to 0.748 L/kg [healthy people]
Protein binding
Not Available
Metabolism
Not Available
Route of elimination

Alpha-interferons are totally filtered through the glomeruli and undergo rapid proteolytic degradation during tubular reabsorption, rendering a negligible reappearance of intact alfa interferon in the systemic circulation.

Half life

The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).

Clearance
  • 2.14 - 3.62 mL/min/kg [healthy]
Toxicity

Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
(R)-warfarinThe metabolism of (R)-warfarin can be decreased when combined with Interferon Alfa-2a, Recombinant.
(S)-WarfarinThe risk or severity of bleeding can be increased when (S)-Warfarin is combined with Interferon Alfa-2a, Recombinant.
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Interferon Alfa-2a, Recombinant is combined with 2-Methoxyethanol.
3-isobutyl-1-methyl-7H-xanthineThe metabolism of 3-isobutyl-1-methyl-7H-xanthine can be decreased when combined with Interferon Alfa-2a, Recombinant.
4-hydroxycoumarinThe risk or severity of bleeding can be increased when 4-hydroxycoumarin is combined with Interferon Alfa-2a, Recombinant.
6-O-benzylguanineThe metabolism of 6-O-benzylguanine can be decreased when combined with Interferon Alfa-2a, Recombinant.
7-DeazaguanineThe metabolism of 7-Deazaguanine can be decreased when combined with Interferon Alfa-2a, Recombinant.
7,9-DimethylguanineThe metabolism of 7,9-Dimethylguanine can be decreased when combined with Interferon Alfa-2a, Recombinant.
8-azaguanineThe metabolism of 8-azaguanine can be decreased when combined with Interferon Alfa-2a, Recombinant.
8-chlorotheophyllineThe metabolism of 8-chlorotheophylline can be decreased when combined with Interferon Alfa-2a, Recombinant.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
  • Avoid alcohol.

References

General References
Not Available
External Links
UniProt
P01563
Genbank
J00207
PubChem Substance
46506712
Therapeutic Targets Database
DAP000801
PharmGKB
PA164779048
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Interferon_Alfa-2a,_Recombinant
ATC Codes
L03AB04 — Interferon alfa-2a
FDA label
Download (204 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedNot AvailableHealthy Volunteers / Lupus / Psoriasis1
1CompletedTreatmentAnus Neoplasms / Human Immunodeficiency Virus (HIV) Infections1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections2
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)2
1CompletedTreatmentPsoriasis1
1, 2WithdrawnTreatmentChronic Lymphocytic Leukaemia (CLL)1
2CompletedTreatmentAdenocarcinomas / Carcinoma NOS / Hypernephroid / Nephroid Carcinoma / Renal Cell / Renal Cell Adenocarcinoma1
2CompletedTreatmentBehcet's Syndrome / Mucocutaneous Ulceration1
2CompletedTreatmentBrain and Central Nervous System Tumors1
2CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection3
2CompletedTreatmentHairy Cell Leukemia (HCL)1
2CompletedTreatmentHepatitis C Viral Infection / Human Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Papillomatosis1
2CompletedTreatmentLeukemias1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedTreatmentMalignant Lymphomas1
2CompletedTreatmentMetastatic Melanoma1
2CompletedTreatmentMetastatic Renal Cell Carcinoma2
2CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
2CompletedTreatmentRefractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
2CompletedTreatmentRenal Cancers1
2CompletedTreatmentRenal Cell Adenocarcinoma2
2CompletedTreatmentRenal Cell Cancer, Recurrent / Stage IV Renal Cell Cancer1
2TerminatedTreatmentCancer, Breast / Metastatic Cancers1
2TerminatedTreatmentChronic Obstructive Pulmonary Disease (COPD) / Coughing / Pulmonary Fibrosis1
2TerminatedTreatmentClear Cell Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
2TerminatedTreatmentMalignancies1
2TerminatedTreatmentRecurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma1
2Unknown StatusDiagnosticRenal Cancers1
2, 3CompletedTreatmentChronic Chronic myelogenous leukemia / Malignant Melanoma / Renal Cell Adenocarcinoma1
3CompletedTreatmentHepatitis C Viral Infection1
3CompletedTreatmentMalignant Lymphomas1
3CompletedTreatmentRenal Cancers1
3CompletedTreatmentRenal Cell Adenocarcinoma1
3RecruitingTreatmentBeh├žet's Disease / Uveitis1
4CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection / End Stage Renal Disease (ESRD)1
4CompletedTreatmentHepatitis B Chronic Infection1
Not AvailableCompletedNot AvailableAdverse Effects / Australia Antigen Positive / Viral Hepatitis B1
Not AvailableCompletedNot AvailableRenal Cell Adenocarcinoma1
Not AvailableNot Yet RecruitingTreatmentViral Hepatitis B1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • F Hoffmann La Roche Ltd.
  • F Hoffmann-La Roche Ltd.
Dosage forms
FormRouteStrength
Powder, for solutionIntramuscular; Subcutaneous
Injection, solutionSubcutaneous11.1 ug/0.5mL
Injection, solutionSubcutaneous22.2 ug/0.5mL
Injection, solutionSubcutaneous33.3 ug/0.5mL
LiquidIntramuscular; Subcutaneous
SolutionIntramuscular; Subcutaneous
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2172664No2000-10-032016-03-26Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
water solubility100 mg/mlNot Available
hydrophobicity-0.336Not Available
isoelectric point5.99Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Type i interferon receptor activity
Specific Function
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JA...
Gene Name
IFNAR1
Uniprot ID
P17181
Uniprot Name
Interferon alpha/beta receptor 1
Molecular Weight
63524.81 Da
References
  1. Dhalluin C, Ross A, Huber W, Gerber P, Brugger D, Gsell B, Senn H: Structural, kinetic, and thermodynamic analysis of the binding of the 40 kDa PEG-interferon-alpha2a and its individual positional isomers to the extracellular domain of the receptor IFNAR2. Bioconjug Chem. 2005 May-Jun;16(3):518-27. [PubMed:15898717]
  2. Cironi P, Swinburne IA, Silver PA: Enhancement of cell type specificity by quantitative modulation of a chimeric ligand. J Biol Chem. 2008 Mar 28;283(13):8469-76. doi: 10.1074/jbc.M708502200. Epub 2008 Jan 29. [PubMed:18230610]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Type i interferon receptor activity
Specific Function
Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are direc...
Gene Name
IFNAR2
Uniprot ID
P48551
Uniprot Name
Interferon alpha/beta receptor 2
Molecular Weight
57758.24 Da
References
  1. Dhalluin C, Ross A, Huber W, Gerber P, Brugger D, Gsell B, Senn H: Structural, kinetic, and thermodynamic analysis of the binding of the 40 kDa PEG-interferon-alpha2a and its individual positional isomers to the extracellular domain of the receptor IFNAR2. Bioconjug Chem. 2005 May-Jun;16(3):518-27. [PubMed:15898717]
  2. Cironi P, Swinburne IA, Silver PA: Enhancement of cell type specificity by quantitative modulation of a chimeric ligand. J Biol Chem. 2008 Mar 28;283(13):8469-76. doi: 10.1074/jbc.M708502200. Epub 2008 Jan 29. [PubMed:18230610]

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
Gene Name
CYP1A2
Uniprot ID
P05177
Uniprot Name
Cytochrome P450 1A2
Molecular Weight
58293.76 Da
References
  1. Delaporte E, Renton KW: Cytochrome P4501A1 and cytochrome P4501A2 are downregulated at both transcriptional and post-transcriptional levels by conditions resulting in interferon-alpha/beta induction. Life Sci. 1997;60(10):787-96. doi: 10.1016/s0024-3205(97)00006-4. [PubMed:9064483]

Drug created on June 13, 2005 07:24 / Updated on September 02, 2019 16:35