You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameBotulinum Toxin Type B
Accession NumberDB00042  (BTD00070, BIOD00070)
TypeBiotech
GroupsApproved
DescriptionNeurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process and purified through a series of precipitation and chromatography steps.
Protein structureDb00042
Related Articles
Protein chemical formulaNot Available
Protein average weight150804.0 Da
Sequences
>Botulinum neurotoxin type B - Clostridium botulinum
MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFN
KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG
DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH
FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY
GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIV
DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN
IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA
YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSN
YIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQY
LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND
FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI
PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY
KALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSV
SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDL
SIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK
LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS
GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING
KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY
SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISD
SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS
KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE
Download FASTA Format
Synonyms
Botulinum neurotoxin type B precursor
BTX-B
RimabotulinumtoxinB
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
MyoblocInjection, solution2500 [USP'U]/.5mLIntramuscularSolstice Neurosciences, LLC2000-12-08Not applicableUs
MyoblocInjection, solution5000 [USP'U]/mLIntramuscularSolstice Neurosciences, LLC2000-12-08Not applicableUs
MyoblocInjection, solution10000 [USP'U]/2mLIntramuscularSolstice Neurosciences, LLC2000-12-08Not applicableUs
MyoblocSolution5000 unitIntramuscularSolstice Neurosciences LlcNot applicableNot applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
NeuroblocSolstice Neurosciences
Brand mixturesNot Available
SaltsNot Available
Categories
UNII0Y70779M1F
CAS number93384-44-2
Pharmacology
IndicationFor the treatment of patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Structured Indications
PharmacodynamicsBotulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of actionBotulinum Toxin Type B binds to and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
TargetKindPharmacological actionActionsOrganismUniProt ID
Vesicle-associated membrane protein 2Proteinyes
binder
HumanP63027 details
Vesicle-associated membrane protein 1Proteinyes
binder
HumanP23763 details
Synaptotagmin-2ProteinyesNot AvailableHumanQ8N9I0 details
Related Articles
AbsorptionThough pharmacokinetic or ADME studies were not performed, Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses.
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityOne unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AclarubicinAclarubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Investigational
AclidiniumAclidinium may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
AmikacinAmikacin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Vet Approved
AmrubicinAmrubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Investigational
Anisotropine MethylbromideAnisotropine Methylbromide may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
annamycinannamycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Investigational
ApramycinApramycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Experimental, Vet Approved
ArbekacinArbekacin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
Atracurium besylateAtracurium besylate may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
AtropineAtropine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved, Vet Approved
BenactyzineBenactyzine may increase the anticholinergic activities of Botulinum Toxin Type B.Withdrawn
BenzatropineBenzatropine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
BiperidenBiperiden may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
Botulinum Toxin Type ABotulinum Toxin Type A may increase the adverse neuromuscular activities of Botulinum Toxin Type B.Approved, Investigational
ChlorphenoxamineChlorphenoxamine may increase the anticholinergic activities of Botulinum Toxin Type B.Withdrawn
Cisatracurium besylateCisatracurium besylate may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
CyclopentolateCyclopentolate may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
DarifenacinDarifenacin may increase the anticholinergic activities of Botulinum Toxin Type B.Approved, Investigational
DaunorubicinDaunorubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
DecamethoniumDecamethonium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
DesloratadineDesloratadine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved, Investigational
DexetimideDexetimide may increase the anticholinergic activities of Botulinum Toxin Type B.Withdrawn
DicyclomineDicyclomine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
DihydrostreptomycinDihydrostreptomycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Vet Approved
Domoic AcidDomoic Acid may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Experimental
Doxacurium chlorideDoxacurium chloride may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
DoxorubicinDoxorubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Investigational
EpirubicinEpirubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
EthopropazineEthopropazine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
FesoterodineFesoterodine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
FramycetinFramycetin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
Gallamine TriethiodideGallamine Triethiodide may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
GeneticinGeneticin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Experimental
GentamicinGentamicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Vet Approved
GENTAMICIN C1AGENTAMICIN C1A may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Experimental
GlycopyrroniumGlycopyrronium may increase the anticholinergic activities of Botulinum Toxin Type B.Approved, Investigational, Vet Approved
HexamethoniumHexamethonium may increase the anticholinergic activities of Botulinum Toxin Type B.Experimental
HomatropineHomatropine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
Hygromycin BHygromycin B may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Vet Approved
HyoscyamineHyoscyamine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
IdarubicinIdarubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
INNO-206INNO-206 may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Investigational
Ipratropium bromideIpratropium bromide may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
KanamycinKanamycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Vet Approved
MecamylamineMecamylamine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
MethanthelineMethantheline may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
MetixeneMetixene may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
MetocurineMetocurine may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
Metocurine IodideMetocurine Iodide may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Withdrawn
MetrizamideMetrizamide may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
MivacuriumMivacurium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
N-butylscopolammonium bromideN-butylscopolammonium bromide may increase the anticholinergic activities of Botulinum Toxin Type B.Vet Approved
NeamineNeamine may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Experimental
NeomycinNeomycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Vet Approved
NeosaxitoxinNeosaxitoxin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Investigational
NetilmicinNetilmicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
NVA237NVA237 may increase the anticholinergic activities of Botulinum Toxin Type B.Investigational
OrphenadrineOrphenadrine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
OxybutyninOxybutynin may increase the anticholinergic activities of Botulinum Toxin Type B.Approved, Investigational
OxyphenoniumOxyphenonium may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
PancuroniumPancuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
ParomomycinParomomycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Investigational
PentoliniumPentolinium may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
PipecuroniumPipecuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
PirarubicinPirarubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Investigational
PirenzepinePirenzepine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
PlicamycinPlicamycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Withdrawn
ProcyclidineProcyclidine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
PropanthelinePropantheline may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
PropiverinePropiverine may increase the anticholinergic activities of Botulinum Toxin Type B.Investigational
PuromycinPuromycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Experimental
PyrantelPyrantel may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Vet Approved
QuinidineQuinidine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
RapacuroniumRapacuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Withdrawn
RibostamycinRibostamycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
RocuroniumRocuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
ScopolamineScopolamine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
Scopolamine butylbromideScopolamine butylbromide may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
SisomicinSisomicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Investigational
SolifenacinSolifenacin may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
SP1049CSP1049C may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Investigational
SpectinomycinSpectinomycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Vet Approved
StreptomycinStreptomycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Vet Approved
StreptozocinStreptozocin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
SuccinylcholineSuccinylcholine may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
TiotropiumTiotropium may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
TobramycinTobramycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved, Investigational
TolterodineTolterodine may increase the anticholinergic activities of Botulinum Toxin Type B.Approved, Investigational
TrihexyphenidylTrihexyphenidyl may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
TrimethaphanTrimethaphan may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
TropicamideTropicamide may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
TrospiumTrospium may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
TubocurarineTubocurarine may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
UmeclidiniumUmeclidinium may increase the anticholinergic activities of Botulinum Toxin Type B.Approved
ValrubicinValrubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
VecuroniumVecuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Approved
ZorubicinZorubicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.Experimental
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Montecucco C, Molgo J: Botulinal neurotoxins: revival of an old killer. Curr Opin Pharmacol. 2005 Jun;5(3):274-9. [PubMed:15907915 ]
  2. Brin MF, Lew MF, Adler CH, Comella CL, Factor SA, Jankovic J, O'Brien C, Murray JJ, Wallace JD, Willmer-Hulme A, Koller M: Safety and efficacy of NeuroBloc (botulinum toxin type B) in type A-resistant cervical dystonia. Neurology. 1999 Oct 22;53(7):1431-8. [PubMed:10534247 ]
  3. Shukla HD, Sharma SK: Clostridium botulinum: a bug with beauty and weapon. Crit Rev Microbiol. 2005;31(1):11-8. [PubMed:15839401 ]
  4. Eisenach JH, Atkinson JL, Fealey RD: Hyperhidrosis: evolving therapies for a well-established phenomenon. Mayo Clin Proc. 2005 May;80(5):657-66. [PubMed:15887434 ]
  5. Schurch B, Corcos J: Botulinum toxin injections for paediatric incontinence. Curr Opin Urol. 2005 Jul;15(4):264-7. [PubMed:15928517 ]
External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB Entries
FDA labelDownload (1.18 MB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntramuscular10000 [USP'U]/2mL
Injection, solutionIntramuscular2500 [USP'U]/.5mL
Injection, solutionIntramuscular5000 [USP'U]/mL
SolutionIntramuscular5000 unit
Prices
Unit descriptionCostUnit
Myobloc 10000 unit/2ml Solution 2ml Vial1245.5USD vial
Myobloc 2500 unit/0.5 ml vial299.4USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
Syntaxin-1 binding
Specific Function:
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Gene Name:
VAMP2
Uniprot ID:
P63027
Molecular Weight:
12662.585 Da
References
  1. Liu W, Montana V, Chapman ER, Mohideen U, Parpura V: Botulinum toxin type B micromechanosensor. Proc Natl Acad Sci U S A. 2003 Nov 11;100(23):13621-5. Epub 2003 Oct 22. [PubMed:14573702 ]
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
Snare binding
Specific Function:
Involved in the targeting and/or fusion of transport vesicles to their target membrane.
Gene Name:
VAMP1
Uniprot ID:
P23763
Molecular Weight:
12901.815 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Syntaxin binding
Specific Function:
Exhibits calcium-dependent phospholipid and inositol polyphosphate binding properties (By similarity). May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).
Gene Name:
SYT2
Uniprot ID:
Q8N9I0
Molecular Weight:
46871.95 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Poulain B, Lonchamp E, Jover E, Popoff MR, Molgo J: [Mechanisms of action of botulinum toxins and neurotoxins]. Ann Dermatol Venereol. 2009 May;136 Suppl 4:S73-6. doi: 10.1016/S0151-9638(09)74531-4. [PubMed:19576489 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23