Lyme disease vaccine (recombinant OspA)

Identification

Name
Lyme disease vaccine (recombinant OspA)
Accession Number
DB00045  (BTD00054, BIOD00054)
Type
Biotech
Groups
Approved, Withdrawn
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

Vaccine against Lyme disease that contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi sensu stricto ZS7, as expressed by Escherichia coli. Lipoprotein OspA is a single polypeptide chain of 257 amino acids with lipids covalently bonded to the N terminus. It is conjugated with alum (aluminum hydroxide) as an adjuvant.

Protein structure
Db00045
Protein chemical formula
C1198H2012N322O422S2
Protein average weight
27743.1 Da
Sequences
> OspA lipoprotein
MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDVPGGMKVLVSKEKNKDGKYDLMATVDN
VDLKGTSDKNNGSGILEGVKADKSKVKLTVADDLSKTTLEVLKEDGTVVSRKVTSKDKST
TEAKFNEKGELSEKTMTRANGTTLEYSQMTNEDNAAKAVETLKNGIKFEGNLASGKTAVE
IKEGTVTLKREIDKNGKVTVSLNDTASGSKKTASWQESTSTLTISANSKKTKDLVFLTNG
TITVQNYDSAGTKLEGSAAEIKKLDELKNALR
Download FASTA Format
Synonyms
  • Lipoprotein OspA antigen recombinant
  • Lipoprotein outer surface a borrelia burgdorferi antigen
  • OspA lipoprotein
International/Other Brands
LYMErix (SmithKline Beecham)
Categories
Not Available
UNII
TA735GI14L
CAS number
Not Available

Pharmacology

Indication

For prophylactic treatment of Lyme Disease

Structured Indications
Not Available
Pharmacodynamics

OspA lipoprotein is a single polypeptide chain of 270 amino acids. It is a vaccination used to prevent Lyme Disease.

Mechanism of action

OspA lipoprotein, an outer surface protein of the bacteria Borrelia burgdorferi sensu stricto ZS7, is used to stimulate the production of specific antibodies against B. burgdorferi. It is used as a vaccination against Lyme Disease, a disease carried by ticks.

TargetActionsOrganism
AToll-like receptor 2
other/unknown
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

1.2 hours (mammalian reticulocytes, in vitro).

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
Not Available
Food Interactions
Not Available

References

General References
Not Available
External Links
UniProt
P14013
Genbank
X16467
PubChem Substance
46504444
Therapeutic Targets Database
DAP001334
PharmGKB
PA164743058

Clinical Trials

Clinical Trials
Not Available

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.652Not Available
isoelectric point6.72Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Other/unknown
General Function
Triacyl lipopeptide binding
Specific Function
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to ...
Gene Name
TLR2
Uniprot ID
O60603
Uniprot Name
Toll-like receptor 2
Molecular Weight
89836.575 Da
References
  1. Welty DM, Snyder DS: Internalization of OspA in rsCD14 complex and aggregated forms. Mol Microbiol. 2003 Nov;50(3):835-43. [PubMed:14617145]

Drug created on June 13, 2005 07:24 / Updated on November 06, 2017 06:43