Identification

Name
Insulin Lispro
Accession Number
DB00046  (BTD00065, BIOD00065, DB01310)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones / Insulins
Description

Insulin lispro is a recombinant human insulin analogue produced in a specialized laboratory strain of Escherischia coli. Plasmid DNA transfected into the bacteria encodes for an analogue of human insulin that has a lysine at residuce B28 and proline at B29; these residues are reversed in endogenous human insulin. Reversal of these amino acid residues produces a rapid-acting insulin analogue. FDA approved on 1996.

Protein structure
Db00046
Protein chemical formula
C257H387N65O76S6
Protein average weight
5808.0 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCN
>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTKPT
Download FASTA Format
Synonyms
  • Insulin lispro (genetical recombination)
  • Insulin lispro (rDNA origin)
  • Insulin lispro protamine
  • Insulin lispro protamine recombinant
  • Insulin lispro recombinant
  • Insulin,lispro,human/rDNA
  • Insulin,lispro,protamine/rDNA
External IDs
LY-275585 / LY275585 / SAR-342434 / SAR342434
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AdmelogInjection, solution100 U/1mLSubcutaneousSanofi Aventis2017-12-11Not applicableUs
AdmelogInjection, solution100 U/1mLIntravenous; SubcutaneousSanofi Aventis2017-12-11Not applicableUs
AdmelogSolution100 unitSubcutaneousSanofi AventisNot applicableNot applicableCanada
AdmelogSolution100 unitSubcutaneousSanofi AventisNot applicableNot applicableCanada
Admelog SolostarSolution100 unitSubcutaneousSanofi AventisNot applicableNot applicableCanada
HumalogInjection, solution100 [iU]/1mLIntravenous; SubcutaneousEli Lilly and Company1996-06-14Not applicableUs
HumalogSolution100 unitIntramuscular; Intravenous; SubcutaneousEli Lilly & Co. Ltd.1996-11-15Not applicableCanada
HumalogInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogInjection, solution100 [iU]/1mLIntravenous; SubcutaneousA-S Medication Solutions1996-06-14Not applicableUs
HumalogInjection, solution100 [iU]/1mLIntravenous; SubcutaneousREMEDYREPACK INC.2018-08-27Not applicableUs
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Humalog Mix 25 (cartridge)Insulin Lispro (25 unit) + Insulin Lispro (75 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.1999-07-05Not applicableCanada
Humalog Mix 25 (cartridge)Insulin Lispro (25 unit) + Insulin Lispro (75 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.1999-07-05Not applicableCanada
Humalog Mix 25 (kwikpen)Insulin Lispro (25 unit) + Insulin Lispro (75 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2013-09-30Not applicableCanada
Humalog Mix 25 (kwikpen)Insulin Lispro (25 unit) + Insulin Lispro (75 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2013-09-30Not applicableCanada
Humalog Mix 25 (pen)Insulin Lispro (25 unit) + Insulin Lispro (75 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2000-01-102011-04-29Canada
Humalog Mix 25 (pen)Insulin Lispro (25 unit) + Insulin Lispro (75 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2000-01-102011-04-29Canada
Humalog Mix 50 (cartridge)Insulin Lispro (50 unit) + Insulin Lispro (50 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2007-01-12Not applicableCanada
Humalog Mix 50 (cartridge)Insulin Lispro (50 unit) + Insulin Lispro (50 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2007-01-12Not applicableCanada
Humalog Mix 50 (kwikpen)Insulin Lispro (50 unit) + Insulin Lispro (50 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2014-01-23Not applicableCanada
Humalog Mix 50 (kwikpen)Insulin Lispro (50 unit) + Insulin Lispro (50 unit)SuspensionSubcutaneousEli Lilly & Co. Ltd.2014-01-23Not applicableCanada
Unapproved/Other Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
HumalogInsulin Lispro (100)Injection, suspensionSubcutaneousEli Lilly and Company2007-09-112007-09-11Us
Humalog Mix50/50Insulin Lispro (100)Injection, suspensionSubcutaneousEli Lilly and Company2007-09-112007-09-11Us
Humalog Mix75/25Insulin Lispro (100)Injection, suspensionSubcutaneousEli Lilly and Company2007-09-112007-09-11Us
Categories
UNII
GFX7QIS1II
CAS number
133107-64-9

Pharmacology

Indication

For the treatment of Type 1 or 2 diabetes mellitus. To be used in conjunction with an intermediate or long-acting insulin except when used in a continuous insulin infusion pump.

Associated Conditions
Pharmacodynamics

Insulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Increased insulin secretion following meals is responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin lispro is a rapid-acting insulin analogue used to mimic postprandial insulin spikes in diabetic individuals. The onset of action of insulin lispro is 10-15 minutes. Its activity peaks 60 minutes following subcutaneous injection and its duration of action is 4-5 hours. Compared to regular human insulin, insulin lispro has a more rapid onset of action and a shorter duration of action. Insulin lispro is also shown to be equipotent to human insulin on a molar basis.

Mechanism of action

Insulin lispro binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism and catabolism. In humans, insulin is stored in the form of hexamers; however, only insulin monomers are able to interact with IR. Reversal of the proline and lysine residues at positions B28 and B29 of native insulin eliminates hydrophobic interactions and weakens some of the hydrogen bonds that contribute to the stability of the insulin dimers that comprise insulin hexamers. Hexamers of insulin lispro are produced in the presence of zinc and m-cresol. These weakly associated hexamers quickly dissociate upon subcutaneous injection and are absorbed as monomers through vascular endothelial cells. These properties give insulin lispro its fast-acting properties.

TargetActionsOrganism
AInsulin receptor
agonist
Human
UInsulin-like growth factor 1 receptorNot AvailableHuman
Absorption

Rapidly absorbed following subcutaneous administration. It is also absorbed more quickly than regular human insulin. Peak serum levels occur 30-90 minutes after injection in healthy subjects. Absorption also differs depending on the site of injection. After insulin lispro was administered in the abdomen, serum drug levels were higher and the duration of action was slightly shorter than after deltoid or thigh administration. Bioavailability, 0.1 - 0.2 unit/kg = 55% - 77%.

Volume of distribution

When administered intravenously as bolus injections of 0.1 and 0.2 U/kg dose in two separate groups of healthy subjects, the mean volume of distribution of insulin lispro appeared to decrease with increase in dose (1.55 and 0.72 L/kg, respectively).

Protein binding
Not Available
Metabolism

Insulin is predominantly cleared by metabolic degradation via a receptor-mediated process.

Route of elimination
Not Available
Half life

SubQ administration = 1 hour

Clearance

Clearance is dose dependent. When a dose of 0.1 unit/kg and 0.2 unit/kg were administered intravenously, the mean clearance was 21.0 mL/min/kg and 9.6 mL/min/kg respectively.

Toxicity

Inappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia. Rare cases of lipoatrophy or lipohypertrophy reactions have been observed.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
2,4-thiazolidinedione2,4-thiazolidinedione may increase the hypoglycemic activities of Insulin Lispro.
5-(2-methylpiperazine-1-sulfonyl)isoquinolineThe therapeutic efficacy of Insulin Lispro can be increased when used in combination with 5-(2-methylpiperazine-1-sulfonyl)isoquinoline.
AcarboseAcarbose may increase the hypoglycemic activities of Insulin Lispro.
AcebutololAcebutolol may increase the hypoglycemic activities of Insulin Lispro.
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Insulin Lispro.
Acetyl sulfisoxazoleThe therapeutic efficacy of Insulin Lispro can be increased when used in combination with Acetyl sulfisoxazole.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Lispro.
AICA ribonucleotideAICA ribonucleotide may increase the hypoglycemic activities of Insulin Lispro.
AlaproclateAlaproclate may increase the hypoglycemic activities of Insulin Lispro.
AlbiglutideAlbiglutide may increase the hypoglycemic activities of Insulin Lispro.
Food Interactions
  • Inject subcutaneuosly 15 minutes before meal

References

General References
  1. Miles HL, Acerini CL: Insulin analog preparations and their use in children and adolescents with type 1 diabetes mellitus. Paediatr Drugs. 2008;10(3):163-76. [PubMed:18454569]
  2. Zib I, Raskin P: Novel insulin analogues and its mitogenic potential. Diabetes Obes Metab. 2006 Nov;8(6):611-20. [PubMed:17026485]
External Links
KEGG Drug
D04477
PubChem Substance
46507498
ChEMBL
CHEMBL1201538
Therapeutic Targets Database
DNC000800
PharmGKB
PA164747059
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Insulin_lispro
ATC Codes
A10AC04 — Insulin lisproA10AB04 — Insulin lisproA10AD04 — Insulin lispro
AHFS Codes
  • 68:20.08 — Insulins
FDA label
Download (1.13 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedNot AvailableDiabetes Mellitus (DM)1
1CompletedNot AvailableDiabetes, Diabetes Mellitus Type 11
1CompletedNot AvailableHealthy Volunteers1
1CompletedBasic ScienceDiabetes, Diabetes Mellitus Type 19
1CompletedBasic ScienceHealthy Participants1
1CompletedBasic ScienceHealthy Volunteers8
1CompletedBasic ScienceType 2 Diabetes Mellitus5
1CompletedBasic ScienceType1 Diabetes Mellitus1
1CompletedDevice FeasibilityType1 Diabetes Mellitus1
1CompletedHealth Services ResearchDiabetes Mellitus (DM)1
1CompletedOtherHealthy Volunteers1
1CompletedTreatmentDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 11
1CompletedTreatmentDiabetes, Diabetes Mellitus Type 110
1CompletedTreatmentHealthy Volunteers2
1CompletedTreatmentType 2 Diabetes Mellitus3
1RecruitingBasic ScienceDiabetes, Diabetes Mellitus Type 11
1RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
1TerminatedTreatmentDiabetes, Diabetes Mellitus Type 11
1Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
1WithdrawnBasic ScienceDiabetes, Diabetes Mellitus Type 12
1WithdrawnBasic ScienceType 2 Diabetes Mellitus1
1WithdrawnHealth Services ResearchBioequivalence in Healthy Subjects3
1, 2CompletedNot AvailableType 2 Diabetes Mellitus1
1, 2CompletedTreatmentDiabetes Mellitus (DM)1
1, 2CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
2CompletedNot AvailableDiabetes, Diabetes Mellitus Type 11
2CompletedNot AvailableType 2 Diabetes Mellitus1
2CompletedBasic ScienceDiabetes Mellitus (DM)1
2CompletedTreatmentDiabetes During Pregnancy1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 18
2CompletedTreatmentImpaired Glucose Tolerance (IGT) / Type 2 Diabetes Mellitus1
2CompletedTreatmentType 2 Diabetes Mellitus1
2CompletedTreatmentType1 Diabetes Mellitus1
2RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
2RecruitingTreatmentSafety and Tolerability1
2TerminatedTreatmentDiabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus1
2, 3RecruitingTreatmentQuality of Life1
3Active Not RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
3Active Not RecruitingTreatmentType 2 Diabetes Mellitus1
3CompletedTreatmentChronic Kidney Disease (CKD) / Type 2 Diabetes Mellitus1
3CompletedTreatmentDiabetes Mellitus (DM)1
3CompletedTreatmentDiabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 12
3CompletedTreatmentDiabetes Mellitus, Insulin-Dependent1
3CompletedTreatmentDiabetes Type 11
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 19
3CompletedTreatmentType 2 Diabetes Mellitus13
3RecruitingTreatmentDiabetes, Diabetes Mellitus Type 12
3TerminatedTreatmentDiabetes, Diabetes Mellitus Type 11
3TerminatedTreatmentHyperglycemias1
3WithdrawnTreatmentType I Diabetes1
4CompletedNot AvailableType 2 Diabetes Mellitus1
4CompletedPreventionCoronary Artery Disease1
4CompletedPreventionHyperglycemias1
4CompletedTreatmentAcute Myocardial Infarction (AMI) / Type 2 Diabetes Mellitus1
4CompletedTreatmentDiabetes, Diabetes Mellitus Type 16
4CompletedTreatmentDiabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus1
4CompletedTreatmentGestational Diabetes Mellitus (GDM)2
4CompletedTreatmentHospitalization / Hyperglycemias / Type 2 Diabetes Mellitus1
4CompletedTreatmentHyperglycemias2
4CompletedTreatmentType 2 Diabetes Mellitus12
4Not Yet RecruitingPreventionDiabetic Nephropathies1
4Not Yet RecruitingTreatmentType 2 Diabetes Mellitus1
4RecruitingPreventionHyperglycemias1
4RecruitingTreatmentDiabetes type11
4RecruitingTreatmentDiabetes, Diabetes Mellitus Type 12
4RecruitingTreatmentType 2 Diabetes Mellitus3
4TerminatedTreatmentDiabetes, Diabetes Mellitus Type 11
4TerminatedTreatmentType 2 Diabetes Mellitus1
4Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
4Unknown StatusTreatmentType 2 Diabetes Mellitus1
4WithdrawnTreatmentDiabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableDiabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus1
Not AvailableCompletedBasic ScienceClamp Study1
Not AvailableCompletedBasic ScienceDiabetes Mellitus (DM)1
Not AvailableCompletedSupportive CareDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableEnrolling by InvitationNot AvailableGestational Diabetes Mellitus (GDM)1
Not AvailableNot Yet RecruitingTreatmentDiabetes Mellitus (DM) / Lipohypertrophy1
Not AvailableNot Yet RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableSuspendedOtherDiabetes, Diabetes Mellitus Type 11
Not AvailableTerminatedTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableWithdrawnNot AvailableDiabetes Mellitus (DM) / Idiopathic orthostatic hypotension / Sarcopenia1
Not AvailableWithdrawnTreatmentAlzheimer's Disease (AD) / Mild Cognitive Impairment (MCI)1

Pharmacoeconomics

Manufacturers
  • Eli lilly and co
Packagers
  • Eli Lilly & Co.
  • Hospira Inc.
  • Lilly Del Caribe Inc.
  • Midwest IV and Home Care
  • Physicians Total Care Inc.
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous100 U/1mL
Injection, solutionSubcutaneous100 U/1mL
SolutionSubcutaneous100 unit
Injection, solutionIntravenous; Subcutaneous100 U/ml
Injection, solutionIntravenous; Subcutaneous100 [iU]/1mL
Injection, solutionSubcutaneous100 [iU]/1mL
Injection, suspensionSubcutaneous100
SolutionIntramuscular; Intravenous; Subcutaneous100 unit
SolutionSubcutaneous200 unit
Injection, solutionSubcutaneous200 U/ml
Injection, solutionSubcutaneous200 [iU]/1mL
SuspensionSubcutaneous
Injection, suspensionSubcutaneous100 U/ml
Injection, suspensionSubcutaneous100 [iU]/1mL
LiquidIntramuscular; Intravenous; Subcutaneous100 unit
Prices
Unit descriptionCostUnit
HumaLOG KwikPen 100 unit/ml Solution (1box = 5 Pens = 15ml)240.18USD box
HumaLOG Mix 50/50 KwikPen 50-50% Suspension Five 3ml Pens Per Box = 15ml240.18USD box
HumaLOG Mix 75/25 KwikPen 75-25% Suspension Five 3ml Pen Per Box = 15ml240.18USD box
HumaLOG Mix 75/25 Pen 75-25% Suspension 15ml Box240.18USD box
HumaLOG Pen (five 3ml Pens Per Box) 15ml Box240.18USD box
HumaLOG 100 unit/ml Solution 1 Box = Five 3ml Cartridges = 15ml231.0USD box
HumaLOG 100 unit/ml Solution 10ml Vial124.36USD vial
Humalog 100 unit/ml kwikpen15.4USD ml
Humalog 100 unit/ml pen15.4USD ml
Humalog mix 50-50 kwikpen15.4USD ml
Humalog mix 50-50 pen15.4USD ml
Humalog mix 50/50 kwikpen11.83USD ml
Humalog 100 unit/ml Cartridge9.37USD cartridge
Humalog 100 unit/ml2.95USD cartridge
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5474978No1994-06-162014-06-16Us
US5514646No1993-05-072013-05-07Us
CA2151564No2003-02-112015-06-12Canada
CA2151560No2000-05-092015-06-12Canada
US9011391No2004-03-262024-03-26Us
US7291132No2004-08-092024-08-09Us
US9233211No2004-03-022024-03-02Us
US8603044No2004-03-022024-03-02Us
US8512297No2004-09-152024-09-15Us
US8679069No2005-04-122025-04-12Us
US8992486No2004-06-052024-06-05Us
US8556864No2004-03-032024-03-03Us
US7918833Yes2008-03-232028-03-23Us
US6551992No1998-06-112018-06-11Us
US6034054No1998-06-112018-06-11Us
US9561331No2004-08-282024-08-28Us
US9623189No2004-08-192024-08-19Us
US9610409No2004-03-022024-03-02Us
US9526844No2004-03-022024-03-02Us
US9604008No2004-03-022024-03-02Us
US9533105No2004-08-172024-08-17Us
US9408979No2004-03-022024-03-02Us
US9604009No2004-08-162024-08-16Us
US9775954No2004-03-022024-03-02Us
US9827379No2004-03-022024-03-02Us
US9717852No2013-04-082033-04-08Us

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)81 °CKhachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001)
hydrophobicity0.218Not Available
isoelectric point5.39Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Receptor signaling protein tyrosine kinase activity
Specific Function
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (...
Gene Name
INSR
Uniprot ID
P06213
Uniprot Name
Insulin receptor
Molecular Weight
156331.465 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Jehle PM, Fussgaenger RD, Kunze U, Dolderer M, Warchol W, Koop I: The human insulin analog insulin lispro improves insulin binding on circulating monocytes of intensively treated insulin-dependent diabetes mellitus patients. J Clin Endocrinol Metab. 1996 Jun;81(6):2319-27. [PubMed:8964871]
  3. Jehle PM, Fussganger RD, Seibold A, Luttke B, Bohm BO: Pharmacodynamics of insulin Lispro in 2 patients with type II diabetes mellitus. Int J Clin Pharmacol Ther. 1996 Nov;34(11):498-503. [PubMed:8937933]
  4. Sciacca L, Cassarino MF, Genua M, Pandini G, Le Moli R, Squatrito S, Vigneri R: Insulin analogues differently activate insulin receptor isoforms and post-receptor signalling. Diabetologia. 2010 Aug;53(8):1743-53. doi: 10.1007/s00125-010-1760-6. Epub 2010 Apr 28. [PubMed:20424816]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Protein tyrosine kinase activity
Specific Function
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involv...
Gene Name
IGF1R
Uniprot ID
P08069
Uniprot Name
Insulin-like growth factor 1 receptor
Molecular Weight
154791.73 Da
References
  1. Smith TJ: Insulin-like growth factor-I regulation of immune function: a potential therapeutic target in autoimmune diseases? Pharmacol Rev. 2010 Jun;62(2):199-236. doi: 10.1124/pr.109.002469. Epub 2010 Apr 14. [PubMed:20392809]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inducer
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
Gene Name
CYP1A2
Uniprot ID
P05177
Uniprot Name
Cytochrome P450 1A2
Molecular Weight
58293.76 Da
References
  1. Drug Interactions: Cytochrome P450 Drug Interaction Table [Link]

Drug created on June 13, 2005 07:24 / Updated on September 22, 2018 22:18