You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInsulin Lispro
Accession NumberDB00046  (BTD00065, BIOD00065, DB01310)
TypeBiotech
GroupsApproved
DescriptionInsulin lispro is a recombinant human insulin analogue produced in a specialized laboratory strain of Escherischia coli. Plasmid DNA transfected into the bacteria encodes for an analogue of human insulin that has a lysine at residuce B28 and proline at B29; these residues are reversed in endogenous human insulin. Reversal of these amino acid residues produces a rapid-acting insulin analogue. FDA approved on 1996.
Protein structureDb00046
Related Articles
Protein chemical formulaC257H387N65O76S6
Protein average weight5808.0 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCN
>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTKPT
Download FASTA Format
Synonyms
Insulin lispro (genetical recombination)
Insulin lispro (rDNA origin)
Insulin lispro protamine
Insulin lispro protamine recombinant
Insulin lispro protamine suspension
Insulin lispro recombinant
Insulin,lispro,human/rDNA
Insulin,lispro,protamine/rDNA
External Identifiers
  • LY-275585
  • LY275585
  • SAR-342434
  • SAR342434
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HumalogInjection, solution100 [iU]/mLIntravenous; SubcutaneousEli Lilly and Company1998-02-20Not applicableUs
HumalogInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogInjection, solution100 [iU]/mLSubcutaneousDispensing Solutions, Inc.1996-07-24Not applicableUs
HumalogInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogInjection, solution100 [iU]/mLIntravenous; SubcutaneousEli Lilly and Company1996-06-14Not applicableUs
HumalogInjection, solution100 [iU]/mLIntravenous; SubcutaneousA S Medication Solutions1996-06-14Not applicableUs
HumalogInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogSolution100 unitIntramuscular; Intravenous; SubcutaneousEli Lilly Canada Inc1996-11-15Not applicableCanada
HumalogInjection, solution100 [iU]/mLSubcutaneousPhysicians Total Care, Inc.2005-05-02Not applicableUs
Humalog (cartridge)Solution100 unitIntramuscular; Intravenous; SubcutaneousEli Lilly Canada Inc1996-11-27Not applicableCanada
Humalog (kwikpen)Solution100 unitIntramuscular; Intravenous; SubcutaneousEli Lilly Canada Inc2013-08-14Not applicableCanada
Humalog 200 Units/ml KwikpenSolution200 unitSubcutaneousEli Lilly Canada Inc2015-09-14Not applicableCanada
Humalog BasalInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog BasalInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Basal KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Basal KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog CartridgeInjection, solution100 [iU]/mLSubcutaneousPhysicians Total Care, Inc.2007-12-03Not applicableUs
Humalog KwikpenInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenInjection, solution200 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenInjection, solution200 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenInjection, solution200 [iU]/mLSubcutaneousEli Lilly and Company2015-05-26Not applicableUs
Humalog KwikpenInjection, solution200 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenInjection, solution100 [iU]/mLIntravenous; SubcutaneousEli Lilly and Company2007-09-06Not applicableUs
Humalog KwikpenInjection, solution200 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50/50Injection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company2006-02-07Not applicableUs
Humalog Mix50/50 KwikpenInjection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company2006-02-07Not applicableUs
Humalog Mix75/25Injection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company1999-12-22Not applicableUs
Humalog Mix75/25 KwikpenInjection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company2008-01-16Not applicableUs
Humalog PenInjection, solution100 [iU]/mLSubcutaneousPhysicians Total Care, Inc.2008-05-12Not applicableUs
Humalog PenLiquid100 unitIntramuscular; Intravenous; SubcutaneousEli Lilly Canada Inc2000-01-102011-04-29Canada
LiprologInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog BasalInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog BasalInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Basal KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Basal KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenInjection, solution200 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenInjection, solution200 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenInjection, solution100 U/mlIntravenous; SubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50Injection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50 KwikpenInjection, suspension100 U/mlSubcutaneousEli Lilly Nederland B.V.2001-08-01Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixtures
NameLabellerIngredients
Humalog Mix 25 (cartridge)Eli Lilly Canada Inc
Humalog Mix 25 (kwikpen)Eli Lilly Canada Inc
Humalog Mix 25 (pen)Eli Lilly Canada Inc
Humalog Mix 50 (cartridge)Eli Lilly Canada Inc
Humalog Mix 50 (kwikpen)Eli Lilly Canada Inc
SaltsNot Available
Categories
UNIIGFX7QIS1II
CAS number133107-64-9
Pharmacology
IndicationFor the treatment of Type 1 or 2 diabetes mellitus. To be used in conjunction with an intermediate or long-acting insulin except when used in a continuous insulin infusion pump.
Structured Indications
PharmacodynamicsInsulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Increased insulin secretion following meals is responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin lispro is a rapid-acting insulin analogue used to mimic postprandial insulin spikes in diabetic individuals. The onset of action of insulin lispro is 10-15 minutes. Its activity peaks 60 minutes following subcutaneous injection and its duration of action is 4-5 hours. Compared to regular human insulin, insulin lispro has a more rapid onset of action and a shorter duration of action. Insulin lispro is also shown to be equipotent to human insulin on a molar basis.
Mechanism of actionInsulin lispro binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism and catabolism. In humans, insulin is stored in the form of hexamers; however, only insulin monomers are able to interact with IR. Reversal of the proline and lysine residues at positions B28 and B29 of native insulin eliminates hydrophobic interactions and weakens some of the hydrogen bonds that contribute to the stability of the insulin dimers that comprise insulin hexamers. Hexamers of insulin lispro are produced in the presence of zinc and m-cresol. These weakly associated hexamers quickly dissociate upon subcutaneous injection and are absorbed as monomers through vascular endothelial cells. These properties give insulin lispro its fast-acting properties.
TargetKindPharmacological actionActionsOrganismUniProt ID
Insulin receptorProteinyes
agonist
HumanP06213 details
Insulin-like growth factor 1 receptorProteinunknownNot AvailableHumanP08069 details
Related Articles
AbsorptionRapidly absorbed following subcutaneous administration. It is also absorbed more quickly than regular human insulin. Peak serum levels occur 30-90 minutes after injection in healthy subjects. Absorption also differs depending on the site of injection. After insulin lispro was administered in the abdomen, serum drug levels were higher and the duration of action was slightly shorter than after deltoid or thigh administration. Bioavailability, 0.1 - 0.2 unit/kg = 55% - 77%.
Volume of distribution

When administered intravenously as bolus injections of 0.1 and 0.2 U/kg dose in two separate groups of healthy subjects, the mean volume of distribution of insulin lispro appeared to decrease with increase in dose (1.55 and 0.72 L/kg, respectively).

Protein bindingNot Available
Metabolism

Insulin is predominantly cleared by metabolic degradation via a receptor-mediated process.

Route of eliminationNot Available
Half lifeSubQ administration = 1 hour
Clearance

Clearance is dose dependent. When a dose of 0.1 unit/kg and 0.2 unit/kg were administered intravenously, the mean clearance was 21.0 mL/min/kg and 9.6 mL/min/kg respectively.

ToxicityInappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia. Rare cases of lipoatrophy or lipohypertrophy reactions have been observed.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Insulin Lispro.Experimental
AcarboseAcarbose may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Lispro.Approved, Vet Approved
AicarAicar may increase the hypoglycemic activities of Insulin Lispro.Experimental
AlogliptinAlogliptin may increase the hypoglycemic activities of Insulin Lispro.Approved
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Insulin Lispro.Approved
AripiprazoleThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Atazanavir.Approved, Investigational
BalaglitazoneBalaglitazone may increase the hypoglycemic activities of Insulin Lispro.Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
BendroflumethiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
BetamethasoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrexpiprazoleThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Brexpiprazole.Approved
BuforminBuformin may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
BumetanideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Buserelin.Approved
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Insulin Lispro.Approved
CaroxazoneCaroxazone may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
CastanospermineCastanospermine may increase the hypoglycemic activities of Insulin Lispro.Experimental
CeritinibThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorpropamideInsulin Lispro may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Chlorthalidone.Approved
CiglitazoneCiglitazone may increase the hypoglycemic activities of Insulin Lispro.Experimental
CinoxacinCinoxacin may increase the hypoglycemic activities of Insulin Lispro.Approved, Withdrawn
CiprofloxacinCiprofloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
CitalopramCitalopram may increase the hypoglycemic activities of Insulin Lispro.Approved
ClozapineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Cortisone acetate.Approved
Cyproterone acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Insulin Lispro.Investigational
DarunavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Darunavir.Approved
DeoxyspergualinDeoxyspergualin may increase the hypoglycemic activities of Insulin Lispro.Investigational
dersalazinedersalazine may increase the hypoglycemic activities of Insulin Lispro.Investigational
DesogestrelThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Insulin Lispro.Approved
DexamethasoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DiazoxideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Diazoxide.Approved
DienogestThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Insulin Lispro.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Insulin Lispro.Illicit
DisopyramideInsulin Lispro may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Drospirenone.Approved
DulaglutideDulaglutide may increase the hypoglycemic activities of Insulin Lispro.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Insulin Lispro.Approved
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Insulin Lispro.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
EpinephrineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
EstradiolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ethinyl Estradiol.Approved
Ethynodiol diacetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Insulin Lispro.Approved
EverolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Everolimus.Approved
ExenatideExenatide may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
FleroxacinFleroxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
FludrocortisoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Insulin Lispro.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Insulin Lispro.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Insulin Lispro.Approved, Vet Approved
FurosemideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Furosemide.Approved, Vet Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Insulin Lispro.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
GlibornurideGlibornuride may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
GliclazideInsulin Lispro may increase the hypoglycemic activities of Gliclazide.Approved
GlimepirideInsulin Lispro may increase the hypoglycemic activities of Glimepiride.Approved
GlipizideInsulin Lispro may increase the hypoglycemic activities of Glipizide.Approved
GliquidoneGliquidone may increase the hypoglycemic activities of Insulin Lispro.Approved
GlyburideInsulin Lispro may increase the hypoglycemic activities of Glyburide.Approved
GoserelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
GusperimusGusperimus may increase the hypoglycemic activities of Insulin Lispro.Investigational
HistrelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Histrelin.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Insulin Lispro.Approved
HydrochlorothiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydroflumethiazide.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
IloperidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Insulin Lispro.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Indinavir.Approved
Insulin AspartInsulin Lispro may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirInsulin Lispro may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineInsulin Lispro may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisineInsulin Lispro may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanInsulin Human may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Insulin Lispro.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Insulin Lispro.Approved
LanreotideInsulin Lispro may increase the hypoglycemic activities of Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Insulin Lispro.Approved
LevonorgestrelThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LinagliptinLinagliptin may increase the hypoglycemic activities of Insulin Lispro.Approved
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Insulin Lispro.Approved, Nutraceutical
LiraglutideLiraglutide may increase the hypoglycemic activities of Insulin Lispro.Approved
LomefloxacinLomefloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
LopinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
MecaserminInsulin Lispro may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Insulin Lispro.Approved
MestranolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Mestranol.Approved
MetforminMetformin may increase the hypoglycemic activities of Insulin Lispro.Approved
MethotrimeprazineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Methyclothiazide.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Insulin Lispro.Investigational
MethylprednisoloneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Insulin Lispro.Approved
MetolazoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Metolazone.Approved
MifepristoneInsulin Lispro may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MiglitolMiglitol may increase the hypoglycemic activities of Insulin Lispro.Approved
MiglustatMiglustat may increase the hypoglycemic activities of Insulin Lispro.Approved
MilnacipranMilnacipran may increase the hypoglycemic activities of Insulin Lispro.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Insulin Lispro.Approved
MitiglinideMitiglinide may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
MoclobemideMoclobemide may increase the hypoglycemic activities of Insulin Lispro.Approved
MoxifloxacinMoxifloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Insulin Lispro.Approved
NateglinideInsulin Lispro may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NCX 4016NCX 4016 may increase the hypoglycemic activities of Insulin Lispro.Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Insulin Lispro.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Insulin Lispro.Investigational
NiacinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
NilotinibThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Insulin Lispro.Investigational
NorethisteroneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
NorgestimateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
OctreotideInsulin Lispro may increase the hypoglycemic activities of Octreotide.Approved, Investigational
OfloxacinOfloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
OlanzapineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Insulin Lispro.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Insulin Lispro.Approved, Illicit
PaliperidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Paliperidone.Approved
PargylinePargyline may increase the hypoglycemic activities of Insulin Lispro.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
PasireotideInsulin Lispro may increase the hypoglycemic activities of Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Insulin Lispro.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Insulin Lispro.Approved
PentamidineInsulin Lispro may increase the hypoglycemic activities of Pentamidine.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Insulin Lispro.Approved
PhenforminPhenformin may increase the hypoglycemic activities of Insulin Lispro.Approved, Withdrawn
PheniprazinePheniprazine may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
PioglitazonePioglitazone may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
PiperazineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Pipotiazine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Insulin Lispro.Approved
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
PolythiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Polythiazide.Approved
PramlintidePramlintide may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
PrednisoloneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProgesteroneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Progesterone.Approved, Vet Approved
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Insulin Lispro.Investigational
QuetiapineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Quinethazone.Approved
QuinineInsulin Lispro may increase the hypoglycemic activities of Quinine.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Insulin Lispro.Approved
RepaglinideInsulin Lispro may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RisperidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ritonavir.Approved, Investigational
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
SafrazineSafrazine may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Insulin Lispro.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Saquinavir.Approved, Investigational
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Insulin Lispro.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Insulin Lispro.Approved
SirolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Sirolimus.Approved, Investigational
SitagliptinSitagliptin may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved
StanozololStanozolol may increase the hypoglycemic activities of Insulin Lispro.Approved, Vet Approved
SulfadiazineInsulin Lispro may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazoleInsulin Lispro may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazoleInsulin Lispro may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SulodexideSulodexide may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
SunitinibInsulin Lispro may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
TemsirolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
ThiazolidinedioneThiazolidinedione may increase the hypoglycemic activities of Insulin Lispro.Investigational
TipranavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamideInsulin Lispro may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamideInsulin Lispro may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Insulin Lispro.Approved
TorasemideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Insulin Lispro.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Insulin Lispro.Approved
TriamcinoloneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TriptorelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TroglitazoneTroglitazone may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Insulin Lispro.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Insulin Lispro.Approved
VildagliptinVildagliptin may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
VogliboseVoglibose may increase the hypoglycemic activities of Insulin Lispro.Approved, Investigational
VorinostatThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Insulin Lispro.Withdrawn
ZiprasidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ziprasidone.Approved
Food Interactions
  • Inject subcutaneuosly 15 minutes before meal
References
Synthesis ReferenceNot Available
General References
  1. Miles HL, Acerini CL: Insulin analog preparations and their use in children and adolescents with type 1 diabetes mellitus. Paediatr Drugs. 2008;10(3):163-76. [PubMed:18454569 ]
  2. Zib I, Raskin P: Novel insulin analogues and its mitogenic potential. Diabetes Obes Metab. 2006 Nov;8(6):611-20. [PubMed:17026485 ]
External Links
ATC CodesA10AC04A10AB04A10AD04
AHFS Codes
  • 68:20.08
PDB Entries
FDA labelDownload (1.13 MB)
MSDSNot Available
Pharmacoeconomics
Manufacturers
  • Eli lilly and co
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous100 [iU]/mL
Injection, solutionIntravenous; Subcutaneous100 U/ml
Injection, solutionSubcutaneous100 [iU]/mL
SolutionIntramuscular; Intravenous; Subcutaneous100 unit
SolutionSubcutaneous200 unit
Injection, solutionSubcutaneous200 U/ml
Injection, solutionSubcutaneous200 [iU]/mL
SuspensionSubcutaneous
Injection, suspensionSubcutaneous100 U/ml
Injection, suspensionSubcutaneous100 [iU]/mL
LiquidIntramuscular; Intravenous; Subcutaneous100 unit
Prices
Unit descriptionCostUnit
HumaLOG KwikPen 100 unit/ml Solution (1box = 5 Pens = 15ml)240.18USD box
HumaLOG Mix 50/50 KwikPen 50-50% Suspension Five 3ml Pens Per Box = 15ml240.18USD box
HumaLOG Mix 75/25 KwikPen 75-25% Suspension Five 3ml Pen Per Box = 15ml240.18USD box
HumaLOG Mix 75/25 Pen 75-25% Suspension 15ml Box240.18USD box
HumaLOG Pen (five 3ml Pens Per Box) 15ml Box240.18USD box
HumaLOG 100 unit/ml Solution 1 Box = Five 3ml Cartridges = 15ml231.0USD box
HumaLOG 100 unit/ml Solution 10ml Vial124.36USD vial
Humalog 100 unit/ml kwikpen15.4USD ml
Humalog 100 unit/ml pen15.4USD ml
Humalog mix 50-50 kwikpen15.4USD ml
Humalog mix 50-50 pen15.4USD ml
Humalog mix 50/50 kwikpen11.83USD ml
Humalog 100 unit/ml Cartridge9.37USD cartridge
Humalog 100 unit/ml2.95USD cartridge
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2151560 No2000-05-092015-06-12Canada
CA2151564 No2003-02-112015-06-12Canada
US5474978 No1994-06-162014-06-16Us
US5514646 No1993-05-072013-05-07Us
US6034054 No1998-06-112018-06-11Us
US6551992 No1998-06-112018-06-11Us
US7291132 No2004-08-092024-08-09Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point81 °CKhachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001)
hydrophobicity0.218Not Available
isoelectric point5.39Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor signaling protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 ...
Gene Name:
INSR
Uniprot ID:
P06213
Molecular Weight:
156331.465 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Jehle PM, Fussgaenger RD, Kunze U, Dolderer M, Warchol W, Koop I: The human insulin analog insulin lispro improves insulin binding on circulating monocytes of intensively treated insulin-dependent diabetes mellitus patients. J Clin Endocrinol Metab. 1996 Jun;81(6):2319-27. [PubMed:8964871 ]
  3. Jehle PM, Fussganger RD, Seibold A, Luttke B, Bohm BO: Pharmacodynamics of insulin Lispro in 2 patients with type II diabetes mellitus. Int J Clin Pharmacol Ther. 1996 Nov;34(11):498-503. [PubMed:8937933 ]
  4. Sciacca L, Cassarino MF, Genua M, Pandini G, Le Moli R, Squatrito S, Vigneri R: Insulin analogues differently activate insulin receptor isoforms and post-receptor signalling. Diabetologia. 2010 Aug;53(8):1743-53. doi: 10.1007/s00125-010-1760-6. Epub 2010 Apr 28. [PubMed:20424816 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation,...
Gene Name:
IGF1R
Uniprot ID:
P08069
Molecular Weight:
154791.73 Da
References
  1. Smith TJ: Insulin-like growth factor-I regulation of immune function: a potential therapeutic target in autoimmune diseases? Pharmacol Rev. 2010 Jun;62(2):199-236. doi: 10.1124/pr.109.002469. Epub 2010 Apr 14. [PubMed:20392809 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inducer
General Function:
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N...
Gene Name:
CYP1A2
Uniprot ID:
P05177
Molecular Weight:
58293.76 Da
References
  1. Drug Interactions: Cytochrome P450 Drug Interaction Table [Link]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on December 03, 2016 02:47