Indium In-111 satumomab pendetide

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
Indium In-111 satumomab pendetide
Accession Number
DB00057  (BTD00108, BIOD00108)
Type
Biotech
Groups
Experimental, Withdrawn
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Tumor associated glycoprotein (TAG) 72 (B72.3) monoclonal antibody conjugated with Indium 111 for radioimaging colon tumors. Satumomab Pendetide (trade name: OncoScint®) is no longer commercially available.

Protein structure
Db00057
Protein chemical formula
C6268H9708N1666O1971S48
Protein average weight
141478.9 Da
Sequences
>Heavy chain 1 B72.3 (murine)
QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWAKQKPEQGLEWIGYISPGNDDIKY
NEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKRSYYGHWGQGTTLTVSSASTKGP
SVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVCPPCKCPAPNLLGGPSVFIFPPKIKDVL
MISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQ
DWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD
FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEG
LHNHHTTKSFSR
>Light chain 1 B72.3 (murine)
DIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGKSPQLLVYAATNLADGVPS
RFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTPYTFGGGTRLEIKRADAAPTVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFN
>Heavy chain 2 B72.3 (murine)
QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWAKQKPEQGLEWIGYISPGNDDIKY
NEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKRSYYGHWGQGTTLTVSSASTKGP
SVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVCPPCKCPAPNLLGGPSVFIFPPKIKDVL
MISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQ
DWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD
FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEG
LHNHHTTKSFSR
>Light chain 2 B72.3 (murine)
DIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGKSPQLLVYAATNLADGVPS
RFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTPYTFGGGTRLEIKRADAAPTVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFN
Download FASTA Format
Synonyms
  • Indium (111In) satumomab pendetide
  • Indium In 111 satumomab pendetide
  • Indium-111 satumomab pendetide
External IDs
CYT-099 / CYT-103
International/Other Brands
OncoScint (Cytogen Corp, Lonza Biologics)
Categories
UNII
7V9926378A
CAS number
138955-27-8

Pharmacology

Indication

For diagnosis of extrahepatic malignant cancers

Pharmacodynamics

Binds to the tumor associated glycoprotein 72 antigen, which is a cell surface protein generally over-expressed in colorectal cancers. The radioactive Indium 111, which is covalently attached to the antibody, allows radiodiagnostic detection of TAG-72 expressing cells and tumors.

Mechanism of action

Satumomab Pendetide is a monoclonal antibody which is attached to the chelator pentetic acid (DTPA) linked to the tripeptide glycine (G) – L-tyrosine (Y) – L-lysine (K), which chelates Indium 111. Satumomab pendetide binds selectively to cell-surface TAG-72 expressed on colorectal tumors.

TargetActionsOrganism
ATumor-associated glycoprotein 72 (TAG-72)
other/unknown
Humans
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system or by human antimurine antibody production

Route of elimination
Not Available
Half life

0.8 hours (mammalian reticulocytes, in vitro)

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Indium In-111 satumomab pendetide.
AbituzumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Abrilumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Indium In-111 satumomab pendetide.
AdecatumumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Adecatumumab.
AducanumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Afelimomab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Alemtuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Amatuximab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Artiko V, Obradovic V, Davidovic B, Petrovic N, Petrovic M, Krivokapic Z, Kecmanovic D, Pesko P, Djukic V, Milosavljevic T, Adanja G, Vlajkovic M: Radioimmunodetection of colorectal carcinoma. Hepatogastroenterology. 2003 Jul-Aug;50(52):1029-31. [PubMed:12845972]
  2. Bohdiewicz PJ: Indium-111 satumomab pendetide: the first FDA-approved monoclonal antibody for tumor imaging. J Nucl Med Technol. 1998 Sep;26(3):155-63; quiz 170-1. [PubMed:9755434]
External Links
PubChem Substance
46505873
ChEMBL
CHEMBL1743091
Therapeutic Targets Database
DAP001299
PharmGKB
PA164745371
ATC Codes
V09IB02 — Indium (111in) satumomab pendetide
MSDS
Download (275 KB)

Clinical Trials

Clinical Trials
Not Available

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • EUSA Pharma Inc.
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.427Not Available
isoelectric point7.02Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

1. Tumor-associated glycoprotein 72 (TAG-72)
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Other/unknown
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Muxi A, Pons F, Vidal-Sicart S, Setoain FJ, Herranz R, Novell F, Fernandez RM, Trias M, Setoain J: Radioimmunoguided surgery of colorectal carcinoma with an 111In-labelled anti-TAG72 monoclonal antibody. Nucl Med Commun. 1999 Feb;20(2):123-30. [PubMed:10088160]

Drug created on June 13, 2005 07:24 / Updated on July 02, 2019 19:56