Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Interferon beta-1b
Accession Number
DB00068  (BTD00078, BIOD00078)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Interferons
Description

Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD

Protein structure
Db00068
Protein chemical formula
C908H1408N246O253S6
Protein average weight
20011.0 Da
Sequences
>DB00068 sequence
SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYE
MLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLH
LKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Download FASTA Format
Synonyms
  • Interferon beta 1b (recombinant)
  • Interferon beta-1b,recombinant
  • Interferon-beta-1b
  • Recombinant interferon beta-1b
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Ag1995-11-30Not applicableEu
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
TTD90R31WZ
CAS number
145155-23-3

Pharmacology

Indication

Interferon beta-1b is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.

Associated Conditions
Pharmacodynamics

Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R.

Mechanism of action

Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.

TargetActionsOrganism
AInterferon alpha/beta receptor 1
agonist
Humans
AInterferon alpha/beta receptor 2
agonist
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption
Not Available
Volume of distribution
  • 0.25 to 2,88 L/kg
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
  • 9.4 – 28.9 mL/min•kg-1 [patients with diseases other than MS receiving single intravenous doses up to 2.0 mg]
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
(R)-warfarinThe metabolism of (R)-warfarin can be decreased when combined with Interferon beta-1b.
(S)-WarfarinThe risk or severity of bleeding can be increased when (S)-Warfarin is combined with Interferon beta-1b.
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Interferon beta-1b is combined with 2-Methoxyethanol.
3-isobutyl-1-methyl-7H-xanthineThe metabolism of 3-isobutyl-1-methyl-7H-xanthine can be decreased when combined with Interferon beta-1b.
4-hydroxycoumarinThe risk or severity of bleeding can be increased when 4-hydroxycoumarin is combined with Interferon beta-1b.
6-O-benzylguanineThe metabolism of 6-O-benzylguanine can be decreased when combined with Interferon beta-1b.
7-DeazaguanineThe metabolism of 7-Deazaguanine can be decreased when combined with Interferon beta-1b.
7,9-DimethylguanineThe metabolism of 7,9-Dimethylguanine can be decreased when combined with Interferon beta-1b.
8-azaguanineThe metabolism of 8-azaguanine can be decreased when combined with Interferon beta-1b.
8-chlorotheophyllineThe metabolism of 8-chlorotheophylline can be decreased when combined with Interferon beta-1b.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

Synthesis Reference

Heinz-Jurgen Friesen, Sidney Pestka, "Preparation of homogeneous human fibroblast interferon." U.S. Patent US4289689, issued December, 1968.

US4289689
General References
  1. Lin L: Betaseron. Dev Biol Stand. 1998;96:97-104. [PubMed:9890522]
  2. Link [Link]
External Links
UniProt
P01574
Genbank
V00534
KEGG Drug
D00746
KEGG Compound
C07901
PubChem Substance
46504458
ChEMBL
CHEMBL1201563
Therapeutic Targets Database
DAP001283
PharmGKB
PA450039
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Interferon_beta-1b
ATC Codes
L03AB08 — Interferon beta-1b
AHFS Codes
  • 92:20.00 — Immunomodulatory Agents
FDA label
Download (1.38 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentDisseminated Sclerosis1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)1
2CompletedNot AvailableDisseminated Sclerosis1
2CompletedTreatmentDisseminated Sclerosis3
2CompletedTreatmentDisseminated Sclerosis / Relapsing-Remitting1
2CompletedTreatmentHeart Diseases / Prophylaxis of cardiomyopathy1
2CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)2
2Not Yet RecruitingTreatmentRelapsing Multiple Sclerosis (RMS)1
2Unknown StatusTreatmentDisseminated Sclerosis1
2, 3RecruitingTreatmentDisseminated Sclerosis / Relapsing Remitting Multiple Sclerosis (RRMS)1
2, 3RecruitingTreatmentMiddle East Respiratory Syndrome Coronavirus (MERS-CoV)1
2, 3TerminatedTreatmentDisseminated Sclerosis1
3CompletedTreatmentDisseminated Sclerosis2
3CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
3CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)2
3WithdrawnTreatmentDisseminated Sclerosis1
4CompletedNot AvailableDisseminated Sclerosis1
4CompletedTreatmentRelapsing Forms of Multiple Sclerosis1
4CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)4
4RecruitingTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)2
4TerminatedPreventionRelapsing Remitting Multiple Sclerosis (RRMS)1
4TerminatedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)2
4Unknown StatusTreatmentDisseminated Sclerosis1
4WithdrawnTreatmentRelapsing Multiple Sclerosis (RMS)1
Not AvailableActive Not RecruitingNot AvailableDisseminated Sclerosis1
Not AvailableCompletedNot AvailableClinically Isolated System / Disseminated Sclerosis1
Not AvailableCompletedNot AvailableDisseminated Sclerosis19
Not AvailableCompletedNot AvailableDisseminated Sclerosis / Low Bone Density1
Not AvailableCompletedNot AvailableDisseminated Sclerosis / Relapsing Remitting Multiple Sclerosis (RRMS)1
Not AvailableCompletedNot AvailableMultiple Sclerosis, Chronic Progressive1
Not AvailableCompletedNot AvailableRelapsing Remitting Multiple Sclerosis (RRMS)5
Not AvailableCompletedNot AvailableRelapsing Remitting Multiple Sclerosis (RRMS) / Secondary Progressive Multiple Sclerosis (SPMS)2
Not AvailableCompletedTreatmentCytomegalovirus Retinitis / Human Immunodeficiency Virus (HIV) Infections1
Not AvailableWithdrawnNot AvailableRelapsing Remitting Multiple Sclerosis (RRMS)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Bayer Healthcare
  • Berlex Labs
  • Chiron Corp.
  • InterMune Inc.
  • Novartis AG
Dosage forms
FormRouteStrength
Injection, powder, for solutionSubcutaneous0.25 mg/ml
KitSubcutaneous0.25 mg/1mL
Powder, for solutionSubcutaneous0.3 mg
Injection, powder, for solutionSubcutaneous250 μg/ml
Prices
Unit descriptionCostUnit
Betaseron 14 0.3 mg Solution 1 Box Contains Fourteen .3 mg Vials.3315.06USD box
Betaseron 0.3 mg kit227.69USD kit
Extavia 0.3 mg kit196.76USD kit
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1340861No1999-12-282016-12-28Canada
CA1339707No1998-03-102015-03-10Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.447Not Available
isoelectric point9.02Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Agonist
General Function
Type i interferon receptor activity
Specific Function
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JA...
Gene Name
IFNAR1
Uniprot ID
P17181
Uniprot Name
Interferon alpha/beta receptor 1
Molecular Weight
63524.81 Da
References
  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [PubMed:10049744]
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Agonist
General Function
Type i interferon receptor activity
Specific Function
Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are direc...
Gene Name
IFNAR2
Uniprot ID
P48551
Uniprot Name
Interferon alpha/beta receptor 2
Molecular Weight
57758.24 Da
References
  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [PubMed:10049744]
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
Gene Name
CYP1A2
Uniprot ID
P05177
Uniprot Name
Cytochrome P450 1A2
Molecular Weight
58293.76 Da
References
  1. Delaporte E, Renton KW: Cytochrome P4501A1 and cytochrome P4501A2 are downregulated at both transcriptional and post-transcriptional levels by conditions resulting in interferon-alpha/beta induction. Life Sci. 1997;60(10):787-96. doi: 10.1016/s0024-3205(97)00006-4. [PubMed:9064483]

Drug created on June 13, 2005 07:24 / Updated on November 20, 2019 12:11