You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInterferon beta-1b
Accession NumberDB00068  (BTD00078, BIOD00078)
TypeBiotech
GroupsApproved
DescriptionHuman interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD
Protein structureDb00068
Related Articles
Protein chemical formulaC908H1408N246O253S6
Protein average weight20011.0 Da
Sequences
>DB00068 sequence
SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYE
MLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLH
LKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Download FASTA Format
Synonyms
Fibroblast interferon
IFN-beta
Interferon beta precursor
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaferonInjection, powder, for solution0.25 mg/mlSubcutaneousBayer Pharma Ag  1995-11-30Not applicableEu
BetaseronKitBayer2009-07-09Not applicableUs
BetaseronPowder, for solution0.3 mgSubcutaneousBayer1995-12-31Not applicableCanada
BetaseronKitBayer2009-07-09Not applicableUs
ExtaviaInjection, powder, for solution250 μg/mlSubcutaneousNovartis Europharm Limited  2008-05-20Not applicableEu
ExtaviaInjection, powder, for solution250 μg/mlSubcutaneousNovartis Europharm Limited  2008-05-20Not applicableEu
ExtaviaInjection, powder, for solution250 μg/mlSubcutaneousNovartis Europharm Limited  2008-05-20Not applicableEu
ExtaviaInjection, powder, for solution250 μg/mlSubcutaneousNovartis Europharm Limited  2008-05-20Not applicableEu
ExtaviaPowder, for solution0.3 mgSubcutaneousNovartis2010-05-05Not applicableCanada
ExtaviaInjection, powder, for solution250 μg/mlSubcutaneousNovartis Europharm Limited  2008-05-20Not applicableEu
ExtaviaKitNovartis2009-08-14Not applicableUs
ExtaviaInjection, powder, for solution250 μg/mlSubcutaneousNovartis Europharm Limited  2008-05-20Not applicableEu
ExtaviaInjection, powder, for solution250 μg/mlSubcutaneousNovartis Europharm Limited  2008-05-20Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIITTD90R31WZ
CAS number145155-23-3
Pharmacology
IndicationInterferon beta-1b is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.
Structured Indications
PharmacodynamicsInterferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R.
Mechanism of actionInterferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
TargetKindPharmacological actionActionsOrganismUniProt ID
Interferon alpha/beta receptor 1Proteinyes
agonist
HumanP17181 details
Interferon alpha/beta receptor 2Proteinyes
agonist
HumanP48551 details
Related Articles
AbsorptionNot Available
Volume of distribution
  • 0.25 to 2,88 L/kg
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
Clearance
  • 9.4 – 28.9 mL/min•kg-1 [patients with diseases other than MS receiving single intravenous doses up to 2.0 mg]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Interferon beta-1b.Approved
Ambroxol acefyllinateThe metabolism of Ambroxol acefyllinate can be decreased when combined with Interferon beta-1b.Experimental
AminophyllineThe metabolism of Aminophylline can be decreased when combined with Interferon beta-1b.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Interferon beta-1b.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Interferon beta-1b.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Interferon beta-1b.Approved, Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Interferon beta-1b.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Interferon beta-1b.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Interferon beta-1b.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Interferon beta-1b.Approved, Investigational
DyphyllineThe metabolism of Dyphylline can be decreased when combined with Interferon beta-1b.Approved
OleandrinAnvirzel may decrease the cardiotoxic activities of Interferon beta-1b.Experimental
OuabainOuabain may decrease the cardiotoxic activities of Interferon beta-1b.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Interferon beta-1b.Approved, Vet Approved
TheophyllineThe metabolism of Theophylline can be decreased when combined with Interferon beta-1b.Approved
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Interferon beta-1b.Approved, Investigational
ZidovudineThe risk or severity of adverse effects can be increased when Interferon beta-1b is combined with Zidovudine.Approved
Food InteractionsNot Available
References
Synthesis Reference

Heinz-Jurgen Friesen, Sidney Pestka, “Preparation of homogeneous human fibroblast interferon.” U.S. Patent US4289689, issued December, 1968.

US4289689
General References
  1. Lin L: Betaseron. Dev Biol Stand. 1998;96:97-104. [PubMed:9890522 ]
  2. Link [Link]
External Links
ATC CodesL03AB08
AHFS CodesNot Available
PDB Entries
FDA labelDownload (1.38 MB)
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)1
1CompletedTreatmentMultiple Sclerosis (MS)1
1, 2CompletedTreatmentAcute Lung Injury (ALI) / Acute Respiratory Distress Syndrome (ARDS)1
2Active Not RecruitingTreatmentMultiple Sclerosis (MS)1
2CompletedNot AvailableMultiple Sclerosis (MS)1
2CompletedTreatmentHeart Diseases / Prophylaxis of cardiomyopathy1
2CompletedTreatmentMultiple Sclerosis (MS)3
2CompletedTreatmentMultiple Sclerosis (MS) / Relapsing-Remitting1
2CompletedTreatmentMultiple Sclerosis, Relapsing-Remitting1
3CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
3CompletedTreatmentMultiple Sclerosis (MS)2
3CompletedTreatmentMultiple Sclerosis, Relapsing-Remitting2
3TerminatedTreatmentRelapsing Multiple Sclerosis (RMS)1
3WithdrawnTreatmentMultiple Sclerosis (MS)1
4Active Not RecruitingTreatmentMultiple Sclerosis (MS)1
4CompletedNot AvailableMultiple Sclerosis (MS)1
4CompletedTreatmentMultiple Sclerosis, Relapsing-Remitting1
4CompletedTreatmentRelapsing Forms of Multiple Sclerosis1
4CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
4CompletedTreatmentRelapsing-Remitting Multiple Sclerosis (RRMS)2
4TerminatedPreventionRelapsing Remitting Multiple Sclerosis (RRMS)1
4TerminatedTreatmentRelapsing-Remitting Multiple Sclerosis (RRMS)1
Not AvailableActive Not RecruitingNot AvailableMultiple Sclerosis (MS)3
Not AvailableActive Not RecruitingNot AvailableMultiple Sclerosis, Relapsing Remitting1
Not AvailableCompletedNot AvailableClinically Isolated System / Multiple Sclerosis (MS)1
Not AvailableCompletedNot AvailableLow Bone Density / Multiple Sclerosis (MS)1
Not AvailableCompletedNot AvailableMultiple Sclerosis (MS)9
Not AvailableCompletedNot AvailableMultiple Sclerosis (MS) / Multiple Sclerosis, Relapsing-Remitting1
Not AvailableCompletedNot AvailableMultiple Sclerosis, Chronic Progressive1
Not AvailableCompletedNot AvailableRelapsing Remitting MS (RRMS) / Secondary Progressive Multiple Sclerosis (SPMS)1
Not AvailableCompletedNot AvailableRelapsing Remitting Multiple Sclerosis (RRMS)1
Not AvailableCompletedNot AvailableRelapsing Remitting Multiple Sclerosis (RRMS) / Secondary Progressive Multiple Sclerosis (SPMS)1
Not AvailableCompletedNot AvailableRelapsing-Remitting Multiple Sclerosis (RRMS)1
Not AvailableCompletedTreatmentCytomegalovirus Retinitis / Human Immunodeficiency Virus (HIV) Infections1
Not AvailableRecruitingNot AvailableMultiple Sclerosis (MS)2
Not AvailableRecruitingNot AvailableMultiple Sclerosis, Relapsing-Remitting1
Not AvailableWithdrawnNot AvailableMultiple Sclerosis, Relapsing-Remitting1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionSubcutaneous0.25 mg/ml
Kit
Kit
Powder, for solutionSubcutaneous0.3 mg
Injection, powder, for solutionSubcutaneous250 μg/ml
Prices
Unit descriptionCostUnit
Betaseron 14 0.3 mg Solution 1 Box Contains Fourteen .3 mg Vials.3315.06USD box
Betaseron 0.3 mg kit227.69USD kit
Extavia 0.3 mg kit196.76USD kit
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339707 No1998-03-102015-03-10Canada
CA1340861 No1999-12-282016-12-28Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.447Not Available
isoelectric point9.02Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Type i interferon receptor activity
Specific Function:
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves. Can also transduce IFNB signals without the help of IFNAR2, and not activating the Jak-STAT pathway.
Gene Name:
IFNAR1
Uniprot ID:
P17181
Molecular Weight:
63524.81 Da
References
  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [PubMed:10049744 ]
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Type i interferon receptor activity
Specific Function:
Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity.
Gene Name:
IFNAR2
Uniprot ID:
P48551
Molecular Weight:
57758.24 Da
References
  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [PubMed:10049744 ]
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23