Identification

Name
Basiliximab
Accession Number
DB00074  (BTD00073, BIOD00073)
Type
Biotech
Groups
Approved, Investigational
Description

A recombinant chimeric (murine/human) monoclonal antibody (IgG1k) that functions as an immunosuppressive agent, specifically binding to and blocking the interleukin-2 receptor a-chain (IL-2R alpha, also known as CD25 antigen) on the surface of activated T-lymphocytes. It is a 144 kDa glycoprotein obtained from fermentation of an established mouse myeloma cell line genetically engineered to express plasmids containing the human heavy and light chain constant region genes and mouse heavy and light chain variable region genes encoding the RFT5 antibody that binds selectively to the IL-2R alpha.

Protein structure
Db00074
Protein chemical formula
C6378H9844N1698O1997S48
Protein average weight
143801.3 Da
Sequences
>Basiliximab heavy chain
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWIKQRPGQGLEWIGAIYPGNSDTSYNQ
KFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPPKSCDKTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
>Basiliximab light chain
QIVSTQSPAIMSASPGEKVTMTCSASSSRSYMQWYQQKPGTSPKRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK
ADYEKHKVYACEVTHQGLSSPVTKSFNRGE
Download FASTA Format
Synonyms
  • chimeric mouse-human antiCD25
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SimulectInjection, powder, for solution20 mg/5mLIntravenousNovartis1998-05-12Not applicableUs
SimulectInjection, powder, for solution20 mgIntravenousNovartis Europharm Limited1998-10-09Not applicableEu
SimulectInjection, powder, for solution10 mg/2.5mLIntravenousNovartis1998-05-12Not applicableUs
SimulectInjection, powder, for solution10 mgIntravenousNovartis Europharm Limited1998-10-09Not applicableEu
SimulectPowder, for solution20 mgIntravenousNovartis2000-10-23Not applicableCanada
Categories
UNII
9927MT646M
CAS number
179045-86-4

Pharmacology

Indication

For prophylactic treatment of kidney transplant rejection

Structured Indications
Pharmacodynamics

Basiliximab functions as an IL-2 receptor antagonist. Specifically it inhibits IL-2-mediated activation of lymphocytes, a critical pathway in the cellular immune response involved in allograft rejection.

Mechanism of action

Basiliximab binds with high-affinity to the alpha-subunit (CD25) of the high-affinity IL-2 receptor. This inhibits IL-2 binding, which inhibits T-cell activation and prevents the body from mounting an immune response against the foreign kidney.

TargetActionsOrganism
AInterleukin-2 receptor subunit alpha
antibody
Human
UInterleukin-2 receptor subunit beta
antibody
Human
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
Absorption
Not Available
Volume of distribution
  • 7.8 ± 5.1 L [Pediatric]
  • 4.8 ± 2.1 L [Adult]
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to lymphocytes, or by human antimurine antibody production

Route of elimination
Not Available
Half life

7.2 +/- 3.2 days (adults)

Clearance
  • 41 +/- 19 mL/h [Adult patients undergoing first kidney transplantation]
  • 17 +/- 6 mL/h [pediatric patients undergoing renal transplantation]
  • 31 +/- 19 mL/h [adolescent patients undergoing renal transplantation]
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Basiliximab.Investigational
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Basiliximab.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Basiliximab.Approved
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Basiliximab.Approved
FingolimodBasiliximab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Basiliximab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Basiliximab.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Basiliximab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Basiliximab.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Basiliximab is combined with Leflunomide.Approved, Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Basiliximab is combined with Natalizumab.Approved, Investigational
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Basiliximab.Approved, Investigational
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Basiliximab.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Basiliximab.Investigational
RoflumilastRoflumilast may increase the immunosuppressive activities of Basiliximab.Approved
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Basiliximab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Basiliximab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Basiliximab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Basiliximab.Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Basiliximab.Approved, Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Basiliximab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Basiliximab.Investigational
TofacitinibBasiliximab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Basiliximab.Approved, Investigational
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Basiliximab.Approved
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Basiliximab.Approved
Food Interactions
Not Available

References

Synthesis Reference
Not Available
General References
Not Available
External Links
UniProt
P01857
Genbank
J00228
ChEMBL
CHEMBL1201439
Therapeutic Targets Database
DAP000388
PharmGKB
PA164747126
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Basiliximab
ATC Codes
L04AC02 — Basiliximab
AHFS Codes
  • 92:00.00
PDB Entries
FDA label
Download (506 KB)
MSDS
Not Available

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1Active Not RecruitingTreatmentAdult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22)1
1Active Not RecruitingTreatmentMalignant Neoplasms Brain1
1RecruitingTreatmentPlasma Cell Myeloma1
1RecruitingTreatmentRecurrent Adult Hodgkin's Lymphoma1
1, 2Unknown StatusTreatmentUremia1
2Active Not RecruitingTreatmentAcute Graft Versus Host Disease / Graft Versus Host Disease (GVHD) / Steroid Refractory GVHD1
2CompletedPreventionAcute Renal Allograft Rejection / Cadaveric Donor Renal Transplantation / Induction Therapy1
2CompletedPreventionTransplantation, Corneal1
2CompletedTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myelogenous Leukaemia (AML) / Agnogenic Myeloid Metaplasia / Aplastic Anaemia (AA) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myelogenous Leukemia (CML) / Hodgkins Disease (HD) / Multiple Myeloma (MM) / Myelodysplasia / Non-Hodgkin's Lymphoma (NHL) / Paroxysmal Hemoglobinuria1
2CompletedTreatmentAmyotrophic Lateral Sclerosis (ALS)1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
2CompletedTreatmentTransplantation, Kidney2
2CompletedTreatmentTransplantation, Renal1
2CompletedTreatmentUlcerative Colitis (UC)1
2Not Yet RecruitingTreatmentDermatomyositis / Lung; Disease, Interstitial, With Fibrosis1
2RecruitingTreatmentAstrocytoma, Grade IV / Giant Cell Glioblastoma / Glioblastoma Multiforme / Glioblastomas1
2RecruitingTreatmentDiabetes, Diabetes Mellitus Type 1 / Transplant, Kidney1
2RecruitingTreatmentFocal Segmental Glomerulosclerosis (FSGS) / Transplantation, Kidney1
2TerminatedPreventionImmunosuppression in Solid Organ Transplant1
2TerminatedTreatmentEnd-Stage Renal Disease (ESRD)1
2TerminatedTreatmentNon-Infectious Uveitis1
2TerminatedTreatmentPrimary Renal Allograft Candidate / Transplantation, Kidney1
2TerminatedTreatmentTransplantation, Kidney / Transplantation, Renal1
2TerminatedTreatmentUlcerative Colitis (UC)1
2Unknown StatusTreatmentChronic Renal Insufficiency / Transplantation, Liver1
2WithdrawnTreatmentDiabetes, Diabetes Mellitus Type 11
2, 3Active Not RecruitingTreatmentTransplantation, Kidney1
2, 3TerminatedTreatmentEnd Stage Renal Disease (ESRD)1
2, 3WithdrawnTreatmentTransplantation, Kidney1
3Active Not RecruitingTreatmentTransplantation, Kidney1
3CompletedPreventionInfection NOS / Transplantation, Liver1
3CompletedPreventionPediatric Kidney Transplantation1
3CompletedPreventionTransplantation, Kidney1
3CompletedPreventionTransplantation, Liver1
3CompletedTreatmentAlpha-1 Antitrypsan Defficiency / Alpha-1 Antitrypsan Deficiency / Chronic Obstructive Pulmonary Disease (COPD) / Emphysema1
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
3CompletedTreatmentEnd Stage Liver Diseases / Impaired Renal Function1
3CompletedTreatmentOrgan Transplantation, Renal Transplantation1
3CompletedTreatmentRejection, Transplant / Transplantation, Kidney1
3CompletedTreatmentRenal Interstitial Fibrosis1
3CompletedTreatmentTransplantation, Kidney1
3CompletedTreatmentTransplantation, Liver3
3RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
3Unknown StatusTreatmentIschemia-Reperfusion Injury / Transplantation, Kidney1
3Unknown StatusTreatmentTransplant, Kidney1
4Active Not RecruitingTreatmentChronic Kidney Disease (CKD) / End Stage Renal Disease (ESRD) / Hemodialysis-dependent patients / Renal Replacement Therapies / Transplantation, Renal1
4Active Not RecruitingTreatmentGlomerulonephritis / IgAN1
4CompletedBasic SciencePharmacokinetics Study in de Novo Kidney Transplantation1
4CompletedPreventionAdverse Effects / Transplantation, Kidney1
4CompletedPreventionDisorder Related to Renal Transplantation1
4CompletedPreventionTransplantation, Kidney2
4CompletedPreventionTransplantation, Liver1
4CompletedPreventionTransplantation, Renal1
4CompletedTreatmentChronic Renal Failure (CRF)1
4CompletedTreatmentDisorder Related to Renal Transplantation / Infections, Cytomegalovirus1
4CompletedTreatmentLiver Cirrhosis / Liver Transplant Disorder1
4CompletedTreatmentRenal Function1
4CompletedTreatmentTransplantation, Kidney1
4CompletedTreatmentTransplantation, Liver1
4RecruitingPreventionBeta-Thalassemia Major1
4RecruitingTreatmentKidney Transplant Rejection1
4RecruitingTreatmentKidney Transplant Rejection / Kidney Transplant; Complications1
4RecruitingTreatmentThalassemia Major (TM)1
4TerminatedTreatmentTransplantation, Kidney1
4TerminatedTreatmentTransplantation, Renal1
4Unknown StatusTreatmentTransplantation, Liver1
4Unknown StatusTreatmentTransplantation, Renal1
Not AvailableAvailableNot AvailableComplete DiGeorge Anomaly / Complete DiGeorge Syndrome / DiGeorge Anomaly / DiGeorge's syndrome1
Not AvailableNo Longer AvailableNot AvailableDiabetes, Diabetes Mellitus Type 11
Not AvailableRecruitingTreatmentTransplantation, Kidney1
Not AvailableSuspendedOtherTransplantation, Kidney1
Not AvailableTerminatedTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myelogenous Leukaemia (AML) / Agnogenic Myeloid Metaplasia / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myelogenous Leukemia (CML) / Hodgkins Disease (HD) / Lymphoma, Mantle-Cell / Multiple Myeloma (MM) / Myelodysplasia / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableUnknown StatusTreatmentGraft Versus Host Disease (GVHD) / Hematopoietic Stem Cell Transplantation (HSCT)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous10 mg/2.5mL
Injection, powder, for solutionIntravenous10 mg
Injection, powder, for solutionIntravenous20 mg/5mL
Injection, powder, for solutionIntravenous20 mg
Powder, for solutionIntravenous20 mg
Prices
Unit descriptionCostUnit
Simulect 20 mg vial2471.6USD vial
Simulect 10 mg vial1883.11USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2038279 No1999-03-092011-03-11Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.473Not Available
isoelectric point8.68Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Interleukin-2 receptor activity
Specific Function
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autorea...
Gene Name
IL2RA
Uniprot ID
P01589
Uniprot Name
Interleukin-2 receptor subunit alpha
Molecular Weight
30818.915 Da
References
  1. Choy BY, Chan TM, Li FK, Lui SL, Lo WK, Yip T, Tse KC, Lai KN: IL2-receptor antagonist (basiliximab) induction therapy is associated with lower morbidity and mortality in renal transplant recipients. Transplant Proc. 2003 Feb;35(1):195. [PubMed:12591363 ]
  2. Kovarik J, Breidenbach T, Gerbeau C, Korn A, Schmidt AG, Nashan B: Disposition and immunodynamics of basiliximab in liver allograft recipients. Clin Pharmacol Ther. 1998 Jul;64(1):66-72. [PubMed:9695721 ]
  3. Garcia CD, Bittencourt VB, Tumelero A, Antonello JS, Malheiros D, Garcia VD: Plasmapheresis for recurrent posttransplant focal segmental glomerulosclerosis. Transplant Proc. 2006 Jul-Aug;38(6):1904-5. [PubMed:16908318 ]
  4. Berard JL, Velez RL, Freeman RB, Tsunoda SM: A review of interleukin-2 receptor antagonists in solid organ transplantation. Pharmacotherapy. 1999 Oct;19(10):1127-37. [PubMed:10512062 ]
  5. Mentre F, Kovarik J, Gerbeau C: Constructing a prediction interval for time to reach a threshold concentration based on a population pharmacokinetic analysis: an application to basiliximab in renal transplantation. J Pharmacokinet Biopharm. 1999 Apr;27(2):213-30. [PubMed:10567956 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Antibody
General Function
Interleukin-2 receptor activity
Specific Function
Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Gene Name
IL2RB
Uniprot ID
P14784
Uniprot Name
Interleukin-2 receptor subunit beta
Molecular Weight
61116.59 Da
References
  1. Onrust SV, Wiseman LR: Basiliximab. Drugs. 1999 Feb;57(2):207-13; discussion 214. [PubMed:10188761 ]
  2. Hausen B, Gummert J, Berry GJ, Christians U, Serkova N, Ikonen T, Hook L, Legay F, Schuler W, Schreier MH, Morris RE: Prevention of acute allograft rejection in nonhuman primate lung transplant recipients: induction with chimeric anti-interleukin-2 receptor monoclonal antibody improves the tolerability and potentiates the immunosuppressive activity of a regimen using low doses of both microemulsion cyclosporine and 40-O-(2-hydroxyethyl)-rapamycin. Transplantation. 2000 Feb 27;69(4):488-96. [PubMed:10708100 ]
  3. Schmitz K, Hitzer S, Behrens-Baumann W: [Immune suppression by combination therapy with basiliximab and cyclosporin in high risk keratoplasty. A pilot study]. Ophthalmologe. 2002 Jan;99(1):38-45. [PubMed:11840795 ]
  4. Warle MC, Kwekkeboom J, Tilanus HW, Metselaar HJ: Basiliximab interferes with the detection of soluble IL-2 receptor by the Immulite Immunoassay system. J Immunol Methods. 2003 Apr 1;275(1-2):133-6. [PubMed:12667677 ]
  5. Emparan C, Laukotter M, Wolters H, Dame C, Heidenreich S, Senninger N: Calcineurin-free protocols with basiliximab induction allow patients included in "old to old" programs achieve standard kidney transplant function. Transplant Proc. 2003 Jun;35(4):1326-7. [PubMed:12826150 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23