Efalizumab

Identification

Name
Efalizumab
Accession Number
DB00095
Description

Humanized IgG1 kappa isotype monoclonal antibody that binds to human CD11a. Efalizumab has a molecular weight of approximately 150 kilodaltons and is produced in a Chinese hamster ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db00095
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>Heavy Chain Variable Region
EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGIMIHPSDSETR
YNQKFKDIRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARIGIYFYGTTYFDYIWGQGTL
VTVSS
>Light Chain Variable Region
DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWXQQKPGKAPKLLIYSGSTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKR
Download FASTA Format
Synonyms
  • anti-CD11a
  • antiCD11 alpha
  • Efalizumab
External IDs
  • HU-1124
  • HU1124

Pharmacology

Indication

For the treatment of adult patients with moderate to severe chronic plaque psoriasis, who are candidates for phototherapy or systemic therapy.

Associated Conditions
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Lymphocyte activation and trafficking to skin play a role in the pathophysiology of chronic plaque psoriasis. In psoriatic skin, ICAM-1 cell surface expression is upregulated on endothelium and keratinocytes. Raptiva inhibits the binding of LFA-1 to the intercellular adhesion molecule-1 (ICAM-1), thereby inhibiting the adhesion of leukocytes to other cell types.

Mechanism of action

Efalizumab binds to CD11a, a subunit of leukocyte function antigen-1 (LFA-1), which is expressed on all leukocytes. As a result efalizumab decreases cell surface expression of CD11a.

TargetActionsOrganism
AIntegrin alpha-L
antibody
Humans
AIntegrin alpha-X
antibody
Humans
Absorption

Average efalizumab bioavailability following subcutaneous administration was estimated at 30 to 50%.

Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half-life

5 days

Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbataceptThe risk or severity of adverse effects can be increased when Efalizumab is combined with Abatacept.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Efalizumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Efalizumab.
Adenovirus type 7 vaccine liveThe risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Efalizumab.
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Efalizumab.
AlefaceptThe risk or severity of adverse effects can be increased when Alefacept is combined with Efalizumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Efalizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Efalizumab is combined with Alirocumab.
AltretamineThe risk or severity of adverse effects can be increased when Efalizumab is combined with Altretamine.
AmsacrineThe risk or severity of adverse effects can be increased when Efalizumab is combined with Amsacrine.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

International/Other Brands
Xanelim
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
RaptivaInjection, powder, for solution100 mg/mlSubcutaneousSerono Europe Limited2004-09-202009-08-03Eu
RaptivaInjection, powder, for solution100 mg/mlSubcutaneousSerono Europe Limited2004-09-202009-08-03Eu
RaptivaPowder, for solutionSubcutaneousEmd Serono, A Division Of Emd Inc., Canada2005-10-262009-06-08Canada
RaptivaInjection, powder, for solution100 mg/mlSubcutaneousSerono Europe Limited2004-09-202009-08-03Eu
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

ATC Codes
L04AA21 — Efalizumab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
XX2MN88N5D
CAS number
214745-43-4

References

General References
  1. Werther WA, Gonzalez TN, O'Connor SJ, McCabe S, Chan B, Hotaling T, Champe M, Fox JA, Jardieu PM, Berman PW, Presta LG: Humanization of an anti-lymphocyte function-associated antigen (LFA)-1 monoclonal antibody and reengineering of the humanized antibody for binding to rhesus LFA-1. J Immunol. 1996 Dec 1;157(11):4986-95. [PubMed:8943405]
  2. Descamps V: [Efalizumab]. Ann Dermatol Venereol. 2006 Aug-Sep;133(8-9 Pt 1):666-78. [PubMed:17053736]
  3. Health Canada Product Monograph: Raptiva (efalizumab) for subcutaneous injection [Link]
PubChem Substance
46505252
RxNav
356988
ChEMBL
CHEMBL1201575
Therapeutic Targets Database
DAP001095
PharmGKB
PA164748817
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Efalizumab
FDA label
Download (1.45 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedTreatmentCandidates for Systemic Therapy for Psoriasis1
4CompletedTreatmentPsoriasis5
4CompletedTreatmentPsoriasis Vulgaris (Plaque Psoriasis)1
4TerminatedNot AvailablePsoriasis Vulgaris (Plaque Psoriasis)1
4TerminatedTreatmentChronic Plaque Psoriasis3
4Unknown StatusTreatmentChronic Plaque Psoriasis1
3CompletedTreatmentPsoriasis5
3CompletedTreatmentPsoriasis, Moderate to Severe2
2CompletedTreatmentAtopic Dermatitis (AD)1
2CompletedTreatmentRheumatoid Arthritis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Genentech Inc.
Dosage Forms
FormRouteStrength
Injection, powder, for solutionSubcutaneous100 mg/ml
Powder, for solutionSubcutaneous
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Metal ion binding
Specific Function
Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated ...
Gene Name
ITGAL
Uniprot ID
P20701
Uniprot Name
Integrin alpha-L
Molecular Weight
128768.495 Da
References
  1. Frampton JE, Plosker GL: Efalizumab: a review of its use in the management of chronic moderate-to-severe plaque psoriasis. Am J Clin Dermatol. 2009;10(1):51-72. doi: 10.2165/0128071-200910010-00009. [PubMed:19170413]
  2. Descamps V: [Efalizumab]. Ann Dermatol Venereol. 2006 Aug-Sep;133(8-9 Pt 1):666-78. [PubMed:17053736]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  4. Wellington K, Perry CM: Efalizumab. Am J Clin Dermatol. 2005;6(2):113-8; discussion 119-20. doi: 10.2165/00128071-200506020-00006. [PubMed:15799683]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis.
Specific Function
Metal ion binding
Gene Name
ITGAX
Uniprot ID
P20702
Uniprot Name
Integrin alpha-X
Molecular Weight
127828.18 Da
References
  1. Pan WZ, Shi CX, Tian M, Yu JG: Anti-CD11c antibody, Efalizumab attenuate ventilator-induced lung injury. Eur Rev Med Pharmacol Sci. 2014;18(15):2182-90. [PubMed:25070825]

Drug created on June 13, 2005 07:24 / Updated on June 12, 2020 10:51

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates