Choriogonadotropin alfa

Identification

Name
Choriogonadotropin alfa
Accession Number
DB00097  (BTD00034, BIOD00034)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones
Description

Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.

Protein structure
Db00097
Protein chemical formula
C1105H1770N318O336S26
Protein average weight
25719.7 Da
Sequences
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
  • Choriogonadotropin alpha
  • Chorionic gonadotropin (recombinant)
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
OvidrelSolution250 mcgSubcutaneousEmd Serono, A Division Of Emd Inc., Canada2004-12-20Not applicableCanada
OvidrelSolution250 mcgSubcutaneousEmd Serono, A Division Of Emd Inc., Canada2013-05-28Not applicableCanada
OvitrelleInjection, solution250 microgramsSubcutaneousMerck Serono Europe Limited2001-02-02Not applicableEu
International/Other Brands
Profasi (Serono S.A.)
Categories
UNII
6413W06WR3
CAS number
177073-44-8

Pharmacology

Indication

For the treatment of female infertility

Structured Indications
Not Available
Pharmacodynamics

Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.

Mechanism of action

Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.

TargetActionsOrganism
ALutropin-choriogonadotropic hormone receptorNot AvailableHuman
AFollicle-stimulating hormone receptor
binder
Human
Absorption

The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.

Volume of distribution
  • 5.9 ± 1.0 L
Protein binding
Not Available
Metabolism
Not Available
Route of elimination

One-tenth of the dose is excreted in the urine.

Half life

The mean terminal half-life is about 29 ± 6 hours (initial half-life is 4.5 ± 0.5 hours).

Clearance
  • 0.29 +/- 0.04 L/h [healthy down-regulated females]
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
Not Available
Food Interactions
Not Available

References

General References
  1. Kayisli UA, Selam B, Guzeloglu-Kayisli O, Demir R, Arici A: Human chorionic gonadotropin contributes to maternal immunotolerance and endometrial apoptosis by regulating Fas-Fas ligand system. J Immunol. 2003 Sep 1;171(5):2305-13. [PubMed:12928375]
  2. Askling J, Erlandsson G, Kaijser M, Akre O, Ekbom A: Sickness in pregnancy and sex of child. Lancet. 1999 Dec 11;354(9195):2053. [PubMed:10636378]
External Links
UniProt
P01233
Genbank
J00117
PubChem Substance
46506863
ChEMBL
CHEMBL1201464
Therapeutic Targets Database
DAP001030
PharmGKB
PA164783947
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Choriogonadotropin_alfa
ATC Codes
G03GA08 — Choriogonadotropin alfa
AHFS Codes
  • 68:18.00 — Gonadotropins
FDA label
Download (97.1 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedBasic SciencePolycystic Ovaries Syndrome1
0CompletedScreeningInfertilities1
0CompletedTreatmentSpontaneous Triggering of Ovulation vs. Administration of Human Chorionic Gonadotropin in Patients Undergoing IUI1
1, 2CompletedTreatmentHealthy Males1
1, 2RecruitingSupportive CareGraft Versus Host Disease (GVHD)1
2CompletedTreatmentAssisted Reproductive Technology therapy / Infertilities1
2CompletedTreatmentFertility Agents, Female1
2CompletedTreatmentInfertilities1
2Not Yet RecruitingTreatmentPituitary gonadotropin hypofunction1
2RecruitingTreatmentAzoospermia1
2TerminatedTreatmentInfertilities / Ovulation induction therapy1
2TerminatedTreatmentOvulation induction therapy2
2TerminatedTreatmentStrokes2
2Unknown StatusTreatmentInfertilities1
2Unknown StatusTreatmentTraumatic Brain Injury (TBI)1
2WithdrawnTreatmentStrokes1
2, 3CompletedTreatmentInfertilities1
3Active Not RecruitingTreatmentInfertilities1
3CompletedDiagnosticPolycystic Ovarian Syndrome1
3CompletedDiagnosticPolycystic Ovaries Syndrome1
3CompletedTreatmentAssisted Reproductive Techniques / Reproductive Technology, Assisted1
3CompletedTreatmentAssisted Reproductive Technology therapy1
3CompletedTreatmentEmbryo Transfer / Luteal Hormone Supplementation in In-vitro Fertilization1
3CompletedTreatmentHyperovulation Induction for Assisted Reproduction Treatment1
3CompletedTreatmentHypogonadism1
3CompletedTreatmentHypogonadism / Idiopathic Hypogonadotropic Hypogonadism1
3CompletedTreatmentInfertilities4
3CompletedTreatmentPolycystic Ovarian Syndrome1
3Not Yet RecruitingTreatmentIn-Vitro Fertilization1
3RecruitingTreatmentIdiopathic Hypogonadotropic Hypogonadism1
3RecruitingTreatmentOvulatory Dysfunction1
3SuspendedTreatmentInfertilities1
3TerminatedSupportive CareFertility / Follicle Stimulating Hormone Deficiency / Infertilities1
3Unknown StatusPreventionCancer, Breast1
3Unknown StatusTreatmentInfertilities1
3WithdrawnTreatmentInfertilities1
4Active Not RecruitingTreatmentInfertilities1
4CompletedNot AvailableInfertilities / Premature Ovarian Failure (POF)1
4CompletedBasic ScienceControlled Ovarian Stimulation / Infertilities1
4CompletedBasic ScienceInfertilities / Subfertility1
4CompletedTreatmentInfertile Women Undergoing Assisted Reproductive Technology (ART)1
4CompletedTreatmentInfertilities3
4CompletedTreatmentInfertility Indicated for ICSI1
4CompletedTreatmentOvarian Hyperstimulation Syndrome1
4CompletedTreatmentPregnancy1
4RecruitingSupportive CareInfertilities2
4RecruitingTreatmentEmbryo Transfer / Luteal Support1
4RecruitingTreatmentIdiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4RecruitingTreatmentInfertilities4
4RecruitingTreatmentInfertilities / Polycystic Ovarian Syndrome1
4TerminatedTreatmentAssisted Reproductive Technology therapy1
4TerminatedTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4Unknown StatusTreatmentEndometrial Thickness / Pregnancy Outcomes1
4Unknown StatusTreatmentInfertilities / Invitro Fertilization1
4Unknown StatusTreatmentOvarian Hyperstimulation Syndrome1
4Unknown StatusTreatmentSupervision of Pregnancy Resulting From In-vitro Fertilization1
Not AvailableCompletedNot AvailableAssisted Reproductive Technology therapy2
Not AvailableCompletedNot AvailableHuman Chorionic Gonadotropin (hCG) Stimulation / Klinefelter's Syndrome / Steroidogenesis1
Not AvailableCompletedNot AvailableInfertilities / Ovulation induction therapy1
Not AvailableCompletedNot AvailableNeonates / Pregnancy3
Not AvailableCompletedDiagnosticHypogonadism / Spinal Cord Injuries (SCI)1
Not AvailableCompletedOtherInfertilities1
Not AvailableCompletedScreeningPolycystic Ovaries Syndrome1
Not AvailableCompletedTreatmentInfertilities3
Not AvailableCompletedTreatmentNatural Cycle in Vitro Fertilization (IVF)1
Not AvailableNot Yet RecruitingTreatmentInfertilities2
Not AvailableRecruitingNot AvailablePolycystic Ovaries Syndrome1
Not AvailableRecruitingTreatmentInfertilities1
Not AvailableRecruitingTreatmentInfertilities / OHSS1
Not AvailableUnknown StatusNot AvailableLow Responders / Mild to Moderate Male Factor Infertility / Primary Infertility / Secondary Infertility1
Not AvailableUnknown StatusDiagnosticEndometrial Receptivity / Ovarian Hyperstimulation Syndrome1
Not AvailableUnknown StatusPreventionInfertility and at High Risk of OHSS1
Not AvailableUnknown StatusTreatmentAssisted Reproductive Technology therapy / Poor Responder1
Not AvailableUnknown StatusTreatmentImplantation Rates / Pregnancy Rate1
Not AvailableUnknown StatusTreatmentInfertilities2

Pharmacoeconomics

Manufacturers
  • Emd serono inc
  • Ferring pharmaceuticals inc
  • App pharmaceuticals llc
  • Bel mar laboratories inc
  • Bristol myers squibb
  • Organon usa inc
Packagers
Dosage forms
FormRouteStrength
SolutionSubcutaneous250 mcg
Injection, solutionSubcutaneous250 micrograms
Prices
Unit descriptionCostUnit
Novarel 10000 unit/10ml Solution 1 Vial = 10ml118.55USD vial
Novarel 10000 unit vial113.99USD vial
Ovidrel 250 mcg/0.5ml Injectable 0.5ml Syringe93.22USD syringe
Pregnyl 10000 unit Solution60.7USD vial
Pregnyl 10000 unit vial57.23USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5767251No1995-06-162015-06-16Us

Properties

State
Solid
Experimental Properties
PropertyValueSource
melting point (°C)55 °CForastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)
hydrophobicity-0.258Not Available
isoelectric point8.61Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
General Function
Luteinizing hormone receptor activity
Specific Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name
LHCGR
Uniprot ID
P22888
Uniprot Name
Lutropin-choriogonadotropic hormone receptor
Molecular Weight
78642.01 Da
References
  1. Bodek G, Vierre S, Rivero-Muller A, Huhtaniemi I, Ziecik AJ, Rahman NA: A novel targeted therapy of Leydig and granulosa cell tumors through the luteinizing hormone receptor using a hecate-chorionic gonadotropin beta conjugate in transgenic mice. Neoplasia. 2005 May;7(5):497-508. [PubMed:15967102]
  2. Gromoll J, Wistuba J, Terwort N, Godmann M, Muller T, Simoni M: A new subclass of the luteinizing hormone/chorionic gonadotropin receptor lacking exon 10 messenger RNA in the New World monkey (Platyrrhini) lineage. Biol Reprod. 2003 Jul;69(1):75-80. Epub 2003 Feb 19. [PubMed:12606382]
  3. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [PubMed:17059863]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Binder
General Function
G-protein coupled peptide receptor activity
Specific Function
Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Induces cAMP production through the activation of PI3K-AKT and S...
Gene Name
FSHR
Uniprot ID
P23945
Uniprot Name
Follicle-stimulating hormone receptor
Molecular Weight
78264.07 Da
References
  1. Jameson JL: Inherited disorders of the gonadotropin hormones. Mol Cell Endocrinol. 1996 Dec 20;125(1-2):143-9. [PubMed:9027352]
  2. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [PubMed:17059863]
  3. Tao YX, Segaloff DL: Follicle stimulating hormone receptor mutations and reproductive disorders. Prog Mol Biol Transl Sci. 2009;89:115-31. doi: 10.1016/S1877-1173(09)89005-4. Epub 2009 Oct 7. [PubMed:20374735]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Drug created on June 13, 2005 07:24 / Updated on December 10, 2017 17:18