Technetium Tc-99m arcitumomab

Identification

Name
Technetium Tc-99m arcitumomab
Accession Number
DB00113  (BTD00107, BIOD00107)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Reduced Fab fragment of the murine IgG1 monoclonal antibody IMMU-4 (also called NP-4) with specificity for carcinoembryonic antigen (CEA) covalently labeled with Technitium 99. The molecule has a molecular weight of ~54,000 Daltons.

Protein structure
Db00113
Protein chemical formula
C6398H9900N1714O1995S54
Protein average weight
144482.5 Da
Sequences
>1clo:Anti-CEA heavy chain 1
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMNWVRQPPGKALEWLGFIGNKANGYTT
EYSASVKGRFTISRDKSQSILYLQMNTLRAEDSATYYCTRDRGLRFYFDYWGQGTTLTVS
SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCPPCKCPAPNLLGGPSVF
IFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLR
VVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKK
QVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERN
SYSCSVVHEGLHNHHTTKSFSR
>1clo: Anti-CEA antigen light chain 1
QTVLSQSPAILSASPGEKVTMTCRASSSVTYIHWYQQKPGSSPKSWIYATSNLASGVPAR
FSGSGSGTSYSLTISRVEAEDAATYYCQHWSSKPPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1clo:Anti-CEA heavy chain 2
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMNWVRQPPGKALEWLGFIGNKANGYTT
EYSASVKGRFTISRDKSQSILYLQMNTLRAEDSATYYCTRDRGLRFYFDYWGQGTTLTVS
SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCPPCKCPAPNLLGGPSVF
IFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLR
VVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKK
QVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERN
SYSCSVVHEGLHNHHTTKSFSR
>1clo: Anti-CEA antigen light chain 2
QTVLSQSPAILSASPGEKVTMTCRASSSVTYIHWYQQKPGSSPKSWIYATSNLASGVPAR
FSGSGSGTSYSLTISRVEAEDAATYYCQHWSSKPPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Download FASTA Format
Synonyms
  • Arcitumomab technetium-99m
  • Technetium (99mTc) arcitumomab
  • Technetium Tc 99m arcitumomab
  • Technetium-99m arcitumomab
International/Other Brands
CEA-Scan (Immunomedics Inc)
Categories
UNII
029JF1SCU8
CAS number
154361-49-6

Pharmacology

Indication

For imaging colorectal tumors

Structured Indications
Not Available
Pharmacodynamics

Binds to the carcinoembryonic antigen, which is a cell surface protein generally overexpressed in colon (and other) cancers. The radioactive Tc99, which is covalently attached to the antibody, allows radiodiagnostic detection of CEA expressing cells and tumors

Mechanism of action

Binds selectively to cell-surface carcinoembryonic antigen (CEA) expressed on colorectal tumors.

TargetActionsOrganism
UCarcinoembryonic antigen-related cell adhesion molecule 1
other/unknown
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system, or by human antimurine antibody production

Route of elimination
Not Available
Half life

Approximately 1 hour

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
Anthrax immune globulin humanThe therapeutic efficacy of Anthrax immune globulin human can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
Bacillus calmette-guerin substrain connaught live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain connaught live antigen can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved, Investigational
Bacillus calmette-guerin substrain tice live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain tice live antigen can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
Hepatitis A VaccineThe therapeutic efficacy of Hepatitis A Vaccine can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
Hepatitis B Vaccine (Recombinant)The therapeutic efficacy of Hepatitis B Vaccine (Recombinant) can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved, Withdrawn
Human rabies virus immune globulinThe therapeutic efficacy of Human rabies virus immune globulin can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated)The therapeutic efficacy of Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated) can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved, Investigational
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved, Investigational
Salmonella typhi ty2 vi polysaccharide antigenThe therapeutic efficacy of Salmonella typhi ty2 vi polysaccharide antigen can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
Salmonella typhi ty21a live antigenThe therapeutic efficacy of Salmonella typhi ty21a live antigen can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Technetium Tc-99m arcitumomab.Investigational
Varicella Zoster Vaccine (Live/Attenuated)The therapeutic efficacy of Varicella Zoster Vaccine (Live/Attenuated) can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved
Yellow Fever VaccineThe therapeutic efficacy of Yellow Fever Vaccine can be decreased when used in combination with Technetium Tc-99m arcitumomab.Approved, Investigational
Food Interactions
Not Available

References

General References
  1. Link [Link]
  2. Link [Link]
  3. Link [Link]
External Links
PubChem Substance
46507781
ChEMBL
CHEMBL2108253
Therapeutic Targets Database
DAP001303
PharmGKB
PA164746540
Wikipedia
Arcitumomab
ATC Codes
V09IA06 — Technetium (99mtc) arcitumomab

Clinical Trials

Clinical Trials
Not Available

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Immunomedics Inc.
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.423Not Available
isoelectric point8.26Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Other/unknown
General Function
Protein homodimerization activity
Specific Function
Not Available
Gene Name
CEACAM1
Uniprot ID
P13688
Uniprot Name
Carcinoembryonic antigen-related cell adhesion molecule 1
Molecular Weight
57559.965 Da
References
  1. Fuster D, Maurel J, Muxi A, Setoain X, Ayuso C, Martin F, Ortega ML, Fuertes S, Pons F: Is there a role for (99m)Tc-anti-CEA monoclonal antibody imaging in the diagnosis of recurrent colorectal carcinoma? Q J Nucl Med. 2003 Jun;47(2):109-15. [PubMed:12865871]
  2. Hughes K, Pinsky CM, Petrelli NJ, Moffat FL, Patt YZ, Hammershaimb L, Goldenberg DM: Use of carcinoembryonic antigen radioimmunodetection and computed tomography for predicting the resectability of recurrent colorectal cancer. Ann Surg. 1997 Nov;226(5):621-31. [PubMed:9389396]

Drug created on June 13, 2005 07:24 / Updated on March 02, 2018 01:52