You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameRanibizumab
Accession NumberDB01270
TypeBiotech
GroupsApproved
DescriptionRanibizumab is a recombinant humanized IgG1 kappa isotype monoclonal antibody fragment designed for intraocular use. Ranibizumab binds to and inhibits the biologic activity of human vascular endothelial growth factor A (VEGF-A). Ranibizumab has a molecular weight of approximately 48 kilodaltons and is produced by an E. coli expression system in a nutrient medium containing the antibiotic tetracycline (tetracycline is not detectable in the final product). Ranibizumab is marketed under the name Lucentis®. It is indicated for the treatment of macular edema after retinal vein occlusion, age-related macular degeneration (wet), and diabetic macular edema.
Protein structureDb01270
Related Articles
Protein chemical formulaC2158H3282N562O681S12
Protein average weight48349.611 Da
Sequences
>Ranibizumab Light Chain
DIQLTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Ranibizumab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPYYYGTSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHL
Download FASTA Format
Synonyms
rhuFab V2
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
LucentisInjection, solution6 mg/mLIntravitrealGenentech, Inc.2012-08-10Not applicableUs
LucentisSolution10 mgIntravitrealNovartis2007-07-26Not applicableCanada
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited  2007-01-22Not applicableEu
LucentisSolution10 mgIntravitrealNovartis2014-09-18Not applicableCanada
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited  2007-01-22Not applicableEu
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited  2007-01-22Not applicableEu
LucentisInjection, solution10 mg/mLIntravitrealGenentech, Inc.2006-06-30Not applicableUs
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited  2007-01-22Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIZL1R02VT79
CAS number347396-82-1
Pharmacology
IndicationFor the treatment of patients with macular edema after retinal vein occlusion, age-related macular degeneration (wet), and diabetic macular edema.
Structured Indications
Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentCutaneous Neurofibromas / Neurofibromatosis Type 11
1Active Not RecruitingTreatmentAge-Related Macular Degeneration (AMD)1
1Active Not RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
1Active Not RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO) / Depression / Retinal Vein Occlusion (RVO) / Venous Retinal Branch Occlusion1
1Active Not RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
1CompletedTreatmentCentral Retinal Vein Occlusion (CRVO)2
1CompletedTreatmentCentral Serous Chorioretinopathy (CSC)1
1CompletedTreatmentChoroidal Melanoma1
1CompletedTreatmentChoroidal Melanoma / Radiation Retinopathy1
1CompletedTreatmentConjunctival Neoplasms1
1CompletedTreatmentCorneal Neovascularization2
1CompletedTreatmentFailing Bleb Following Trabeculectomy / Open-angle Glaucoma (OAG)1
1CompletedTreatmentIschemic Central Retinal Vein Occlusion1
1CompletedTreatmentMacular Telangiectasia1
1CompletedTreatmentMyopia, Degenerative1
1CompletedTreatmentNeovascularization1
1CompletedTreatmentNonarteritic Anterior Ischemic Optic Neuropathy1
1CompletedTreatmentProliferative Diabetic Retinopathy (PDR) / Rubeosis Iridis1
1CompletedTreatmentPterygium1
1CompletedTreatmentRadiation Retinopathy1
1CompletedTreatmentRetinal Pigment Epithelial Detachment1
1CompletedTreatmentRetinal Vein Occlusion (RVO)1
1CompletedTreatmentSubfoveal Choroidal Neovascularization2
1CompletedTreatmentTelangiectasias3
1CompletedTreatmentUveitic Cystoid Macular Edema1
1CompletedTreatmentVon Hippel-Lindau Syndrome1
1RecruitingTreatmentCystoid Macular Edema1
1RecruitingTreatmentEye Diseases / Macular Degeneration / Neovascularization, Pathologic / Retinal Degenerations / Retinal Diseases1
1RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
1RecruitingTreatmentPterygium1
1TerminatedTreatmentEye Diseases / Ischaemia / Pathologic Processes / Retinal Diseases / Retinal Vein Occlusion (RVO)1
1WithdrawnTreatmentAge Related Macular Degeneration (ARMD) / AMD / CNV1
1WithdrawnTreatmentDiabetic Macular Edema (DME)1
1WithdrawnTreatmentHereditary Haemorrhagic Telangiectasia (HHT) / Nosebleeds1
1WithdrawnTreatmentPort-wine Stains (PWS)1
1, 2Active Not RecruitingTreatmentDiabetic Macular Edema (DME)3
1, 2Active Not RecruitingTreatmentPolypoidal Choroidal Vasculopathy1
1, 2Active Not RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
1, 2CompletedBasic ScienceAge-Related Macular Degeneration (ARMD) / Diabetic Macular Edema (DME) / Retinal Vein Occlusion (RVO)1
1, 2CompletedSupportive CareExudative Age-Related Macular Degeneration1
1, 2CompletedTreatmentAge Related Macular Degeneration (AMD)1
1, 2CompletedTreatmentAge Related Macular Degeneration (ARMD)1
1, 2CompletedTreatmentBEST VITELLIFORM MACULAR DYSTROPHY, MULTIFOCAL (Disorder) / Coats' Disease / Idiopathic Retinal Telangiectasia / Multi-focal Choroiditis / Pathological Myopia / Polypoidal Choroidal Vasculopathy / Pseudoxanthoma Elasticum / Retinal Angiomatous Proliferation / Rubeosis Iridis / Von Hippel Lindau Disease1
1, 2CompletedTreatmentBranch Retinal Vein Occlusion / Central Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
1, 2CompletedTreatmentCardiovascular Diseases / Diabetic Angiopathies / Eye Diseases / Retinal Diseases / Retinopathy, Diabetic / Vascular Diseases1
1, 2CompletedTreatmentChronic Central Serous Chorioretinopathy1
1, 2CompletedTreatmentClinically Significant Diabetic Macular Edema1
1, 2CompletedTreatmentCytoid Macular Edema / Uveitis1
1, 2CompletedTreatmentDiabetic Macular Edema (DME)1
1, 2CompletedTreatmentExudative Macular Degeneration1
1, 2CompletedTreatmentMacular Degeneration2
1, 2CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
1, 2CompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusion (RVO)1
1, 2CompletedTreatmentMaculopathies, Age-Related1
1, 2CompletedTreatmentNeovascular Age-Related Macular Degeneration1
1, 2CompletedTreatmentPCV / Polypoidal Choroidal Vasculopathy1
1, 2CompletedTreatmentPolypoidal Choroidal Vasculopathy1
1, 2CompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
1, 2CompletedTreatmentSubfoveal Choroidal Neovascularization(CNV) Secondary to Age-related Macular Degeneration (AMD)1
1, 2RecruitingPreventionAge-Related Macular Degeneration (ARMD)2
1, 2RecruitingTreatmentDiabetic Macular Edema (DME)1
1, 2RecruitingTreatmentDiabetic Macular Edema (DME) / Hard Lipid Exudates1
1, 2RecruitingTreatmentOcular Histoplasmosis Syndrome1
1, 2RecruitingTreatmentRecalcitrant Wet Age-related Macular Degeneration1
1, 2RecruitingTreatmentVon Hippel-Lindau Syndrome1
1, 2TerminatedTreatmentAge Related Macular Degeneration (ARMD) / Choroidal Neovascular Membrane / Macular Degeneration / Subfoveal Neovascular Age-Related Macular Degeneration / Wet Age-Related Macular Degeneration1
1, 2WithdrawnTreatmentAngioid Streaks1
1, 2WithdrawnTreatmentGlaucoma / Glaucoma, Neovascular / New Onset Glaucoma / New Onset Neovascular Glaucoma1
2Active Not RecruitingTreatmentAge Related Macular Degeneration (ARMD)1
2Active Not RecruitingTreatmentDiabetes Mellitus (DM) / Diabetic Macular Edema (DME)1
2Active Not RecruitingTreatmentDiabetic Macular Edema (DME)2
2Active Not RecruitingTreatmentMacular Degeneration / Pigment Epithelium of Eye / Retinal Detachment / Wet Macular Degeneration1
2Active Not RecruitingTreatmentMacular Edema (ME) / Retinopathy, Diabetic2
2Active Not RecruitingTreatmentRetinopathy, Diabetic1
2CompletedNot AvailableWet AMD1
2CompletedTreatmentAge Related Macular Degeneration (ARMD)4
2CompletedTreatmentAge-Related Macular Degeneration (ARMD)3
2CompletedTreatmentBranch Retinal Vein Occlusion / Macular Edema (ME)1
2CompletedTreatmentDiabetic Macular Edema (DME)2
2CompletedTreatmentDiabetic Macular Edema (DME) / Retinopathy, Diabetic1
2CompletedTreatmentDiabetic Macular Edema (DME) / Retinopathy, Diabetic / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentDiabetic Macular Edema (DME) / Visual Impairment1
2CompletedTreatmentExudative Age-Related Macular Degeneration3
2CompletedTreatmentMacular Degeneration5
2CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentMacular Edema (ME)2
2CompletedTreatmentNeovascular Age Related Macular Degeneration1
2CompletedTreatmentNeovascular Age-Related Macular Degeneration2
2CompletedTreatmentPigment Epithelial Detachment1
2CompletedTreatmentRetinal Detachment / Retinopathy, Diabetic1
2CompletedTreatmentRetinal Diseases / Telangiectasis1
2CompletedTreatmentRetinal Neovascularization / Retinopathy, Diabetic1
2CompletedTreatmentSubfoveal Choroidal Neovascularization1
2CompletedTreatmentType 2 Idiopathic Macular Telangiectasia1
2Not Yet RecruitingTreatmentDiabetic Macular Edema (DME)1
2Not Yet RecruitingTreatmentPosterior Vitreous Detachment / Retinal Vein Occlusion (RVO)1
2RecruitingNot AvailableDiabetic Macular Edema (DME)1
2RecruitingBasic ScienceGlaucoma, Neovascular / Macular Degeneration / Macular Hole / Proliferative Diabetic Retinopathy (PDR)1
2RecruitingTreatmentAge-Related Macular Degeneration (AMD) / AMD / Exudative Age-Related Macular Degeneration / Eye Diseases / Macular Degeneration / Macular Degeneration, Age-related, 10 / Retinal Degenerations / Retinal Diseases1
2RecruitingTreatmentAge-Related Macular Degeneration (ARMD)2
2RecruitingTreatmentBranch Retinal Vein Occlusion1
2RecruitingTreatmentDiabetic Macular Edema (DME)4
2RecruitingTreatmentExudative Age-Related Macular Degeneration1
2RecruitingTreatmentMacular Degeneration1
2RecruitingTreatmentMacular Degeneration, Choroidal Neovascularization1
2RecruitingTreatmentMacular Edema (ME) / Retinal Vein Occlusion (RVO)1
2RecruitingTreatmentPresumed Ocular Histoplasmosis (POHS)1
2RecruitingTreatmentRadiation Retinopathy1
2RecruitingTreatmentRetinoblastoma1
2RecruitingTreatmentSteroid-induced Glaucoma - Borderline / Uveitis Related Cystoid Macular Edema1
2RecruitingTreatmentWet Macular Degeneration2
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD) / Choroid Neovascularization1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD) / Choroidal Neo-Vascular Age-onset Macular Degeneration1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
2TerminatedTreatmentMacular Edema (ME) / Proliferative Diabetic Retinopathy (PDR)1
2TerminatedTreatmentMacular Edema, Diabetic1
2WithdrawnTreatmentDiabetic Macular Edema (DME)1
2WithdrawnTreatmentMacular Edema (ME) / Uveitis1
2WithdrawnTreatmentPersistent Diabetic Macular Edema1
2, 3Active Not RecruitingTreatmentDiabetes Complications1
2, 3Active Not RecruitingTreatmentDiabetic Macular Edema (DME)1
2, 3CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Neovascular Macular Degeneration / Pigment Epithelial Detachment / Wet Macular Degeneration1
2, 3CompletedTreatmentEales' Disease1
2, 3CompletedTreatmentGlaucoma1
2, 3CompletedTreatmentProliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
2, 3CompletedTreatmentPterygium1
2, 3Not Yet RecruitingTreatmentUveal Melanoma1
2, 3RecruitingBasic ScienceAge Related Macular Degeneration (ARMD)1
2, 3RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
2, 3RecruitingTreatmentDiabetic Macular Edema (DME)1
2, 3RecruitingTreatmentExudative Macular Degeneration / Retinal Hemorrhage1
2, 3RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
2, 3RecruitingTreatmentRetinal Vein Occlusion (RVO)1
2, 3TerminatedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
3Active Not RecruitingTreatmentAge Related Macular Degeneration (ARMD)2
3Active Not RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
3Active Not RecruitingTreatmentBranch Retinal Vein Occlusion1
3Active Not RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)1
3Active Not RecruitingTreatmentChoroidal Neovascularization Secondary to Pathologic Myopia1
3Active Not RecruitingTreatmentGlaucoma, Neovascular / Macular Edema (ME) / Retinopathy, Diabetic / Subfoveal Choroidal Neovascularization1
3Active Not RecruitingTreatmentMacular Degeneration2
3Active Not RecruitingTreatmentVisual Impairment Due to Choroidal Neovascularization Secondary to Pathologic Myopia1
3CompletedNot AvailableDiabetic Macular Edema (DME)1
3CompletedNot AvailableNeovascular Age-Related Macular Degeneration1
3CompletedSupportive CareAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentAge Related Macular Degeneration (ARMD)2
3CompletedTreatmentAge Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
3CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization3
3CompletedTreatmentBranch Retinal Vein Occlusion1
3CompletedTreatmentBranch Retinal Vein Occlusion / Macular Edema (ME) / Visual Impairment1
3CompletedTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
3CompletedTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME) / Visual Impairment1
3CompletedTreatmentChoroidal Neovascularization (CNV)1
3CompletedTreatmentDiabetes Mellitus (DM) / Macular Edema (ME)2
3CompletedTreatmentDiabetic Macular Edema (DME)4
3CompletedTreatmentDiabetic Macular Edema (DME) / Proliferative Diabetic Retinopathy (PDR)1
3CompletedTreatmentDiabetic Macular Edema (DME) / Proliferative Diabetic Retinopathy (PDR) / Retinopathy, Diabetic1
3CompletedTreatmentDiabetic Macular Edema (DME) / Retinopathy, Diabetic1
3CompletedTreatmentGlaucoma / Rubeosis Iridis1
3CompletedTreatmentMacular Degeneration6
3CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentMacular Edema (ME)1
3CompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusion (RVO)2
3CompletedTreatmentNeovascular Age-Related Macular Degeneration1
3CompletedTreatmentPathological Myopia1
3CompletedTreatmentRetinal Vein Occlusion (RVO)2
3Enrolling by InvitationTreatmentMacular Edema (ME) / Retinal Vein Occlusion (RVO)1
3Not Yet RecruitingTreatmentMacular Edema (ME) / Uveitis1
3Not Yet RecruitingTreatmentRetinopathy of Prematurity2
3Not Yet RecruitingTreatmentWet Age-Related Macular Degeneration1
3RecruitingPreventionProliferative Diabetic Retinopathy (PDR)1
3RecruitingTreatmentAge Related Macular Degeneration (ARMD)2
3RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
3RecruitingTreatmentAge-Related Neovascular Macular Degeneration1
3RecruitingTreatmentBranch Retinal Vein Occlusion1
3RecruitingTreatmentMacular Degeneration2
3RecruitingTreatmentNeovascular (Wet) Age-related Macular Degeneration (AMD)1
3RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
3RecruitingTreatmentVision Impairment Due to Diabetic Macular Edema1
3TerminatedTreatmentMacular Degeneration1
3WithdrawnTreatmentAge Related Macular Degeneration (ARMD)1
4Active Not RecruitingPreventionRadiation Maculopathy / Radiation Retinopathy / Uveal Melanoma1
4Active Not RecruitingTreatmentAge-related Macular Degeneration; Polypoidal Choroidal Vasculopathy (PCV)1
4Active Not RecruitingTreatmentBranch Retinal Vein Occlusion / Macular Edema (ME)1
4Active Not RecruitingTreatmentDiabetic Macular Edema (DME)1
4Active Not RecruitingTreatmentMacular Degeneration2
4Active Not RecruitingTreatmentNeovascular Age Related Macular Degeneration1
4Active Not RecruitingTreatmentPigment Epithelial Detachment1
4Active Not RecruitingTreatmentRetinal Neovascularisation / Retinopathy, Diabetic1
4Active Not RecruitingTreatmentSubfoveal Choroidal Neovascularization (CNV) Secondary to Wet Age-related Macular Degeneration (AMD)1
4Active Not RecruitingTreatmentWet Age Related Macular Degeneration1
4CompletedNot AvailableMacular Degeneration1
4CompletedTreatmentAge Related Macular Degeneration (ARMD)1
4CompletedTreatmentAge-Related Macular Degeneration (ARMD)3
4CompletedTreatmentCentral Retinal Vein Occlusion (CRVO)1
4CompletedTreatmentCentral Retinal, Hemi Retinal & Brach Retinal Vein Occlusions1
4CompletedTreatmentDiabetic Macular Edema (DME)1
4CompletedTreatmentExudative Age-Related Macular Degeneration3
4CompletedTreatmentGlaucoma, Neovascular / Retinopathy, Diabetic1
4CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
4CompletedTreatmentMacular Edema (ME)1
4CompletedTreatmentMacular Edema (ME) / Visual Impairment1
4CompletedTreatmentMacular Oedema / Retinopathy, Diabetic1
4CompletedTreatmentMaculopathies, Age-Related / Subfoveal Choroidal Neovascularization1
4CompletedTreatmentNeovascular Age-Related Macular Degeneration1
4CompletedTreatmentPolypoidal Choroidal Vasculopathy1
4CompletedTreatmentRetinal Diseases1
4CompletedTreatmentRetinal Pigment Epithelial Detachment / Subfoveal Choroidal Neovascularization1
4CompletedTreatmentRetinal Vein Occlusion (RVO)1
4CompletedTreatmentRetinopathy, Diabetic1
4CompletedTreatmentSecondary to Age-related Macular Degeneration (AMD) / Subfoveal Choroidal Neovascularization (CNV)1
4CompletedTreatmentWet Macular Degeneration1
4Not Yet RecruitingBasic ScienceAge-Related Macular Degeneration (ARMD)1
4Not Yet RecruitingBasic ScienceExudative Age-Related Macular Degeneration / Polypoidal Choroidal Vasculopathy1
4Not Yet RecruitingTreatmentCentral Retinal Vein Occlusion With Macular Edema1
4Not Yet RecruitingTreatmentDiabetic Macular Edema (DME)1
4Not Yet RecruitingTreatmentMacular Degeneration / Visual Acuity1
4Not Yet RecruitingTreatmentWet Age-related Macular Degeneration (Wet AMD)1
4RecruitingTreatmentAge-Related Macular Degeneration (ARMD)2
4RecruitingTreatmentBranch Retinal Vein Occlusion2
4RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)1
4RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
4RecruitingTreatmentDiabetic Macula Edema2
4RecruitingTreatmentDiabetic Macular Edema (DME)1
4RecruitingTreatmentMacular Diseases1
4RecruitingTreatmentMacular Edema, Cystoid / Visual Acuity Reduced Transiently1
4RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
4RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
4RecruitingTreatmentVisual Impairment Due to Neovascular AMD1
4SuspendedTreatmentVisual Impairment Due to Diabetic Macular Edema1
4TerminatedScreeningAge-Related Macular Degeneration (ARMD) / Cerebrovascular Disorders / Coronary Artery Disease1
4TerminatedTreatmentAge-Related Macular Degeneration (ARMD)1
Not AvailableActive Not RecruitingNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableActive Not RecruitingNot AvailableDiabetic Macular Edema (DME)1
Not AvailableActive Not RecruitingTreatmentAge Related Macular Degeneration (ARMD) / Retinal Pigment Epithelial Detachment With Vascularization1
Not AvailableActive Not RecruitingTreatmentResearcher-Subject Relations1
Not AvailableAvailableNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableCompletedNot AvailableAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedNot AvailableMacular Degeneration1
Not AvailableCompletedNot AvailableMacular Degeneration / Macular Edema (ME) / Ophthalmology1
Not AvailableCompletedNot AvailableMacular Edema (ME) / Retinal Vein Occlusion (RVO)1
Not AvailableCompletedNot AvailableOphthalmology, Macular Degeneration1
Not AvailableCompletedNot AvailableSubfoveal Choroidal Neovascularization1
Not AvailableCompletedDiagnosticAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedDiagnosticAge-Related Macular Degeneration (ARMD) / Retinal Function1
Not AvailableCompletedHealth Services ResearchDiabetic Macular Edema (DME) / Exudative Macular Degeneration1
Not AvailableCompletedTreatmentAge Related Macular Degeneration (ARMD)1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD) / Central Retinal Vein Occlusion (CRVO) / Diabetic Macular Edema (DME)1
Not AvailableCompletedTreatmentEpiretinal Membrane1
Not AvailableCompletedTreatmentGlaucoma1
Not AvailableCompletedTreatmentGlaucoma, Neovascular / Rubeosis1
Not AvailableCompletedTreatmentGlaucoma / Trabeculectomy1
Not AvailableCompletedTreatmentMacular Edema (ME)1
Not AvailableCompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusion (RVO)1
Not AvailableNot Yet RecruitingNot AvailableAge-Related Macular Degeneration (ARMD)1
Not AvailableRecruitingNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableRecruitingNot AvailableAge-Related Macular Degeneration (ARMD) / Geographic Atrophy1
Not AvailableRecruitingNot AvailableDiabetic Macular Edema (DME)1
Not AvailableRecruitingNot AvailableDiabetic Macular Edema (DME) / Retinal Vein Occlusion (RVO) / Wet Age Related Macular Degeneration / Wet Age Related Macular Degeneration, Diabetic Macular Edema, Retinal Vein Occlusion1
Not AvailableRecruitingNot AvailableMacular Diseases1
Not AvailableRecruitingNot AvailableMacular Edema (ME)1
Not AvailableRecruitingNot AvailableNeovascular Age Related Macular Degeneration1
Not AvailableRecruitingTreatmentAge Related Macular Degeneration (ARMD)1
Not AvailableRecruitingTreatmentAge-Related Macular Degeneration (ARMD)3
Not AvailableRecruitingTreatmentBranch Retinal Vein Occlusion / Central Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
Not AvailableRecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)1
Not AvailableRecruitingTreatmentDiabetic Macular Oedema1
Not AvailableRecruitingTreatmentExudative Age-Related Macular Degeneration1
Not AvailableRecruitingTreatmentRetinal Vein Occlusion (RVO)1
Not AvailableTerminatedNot AvailableMaculopathies, Age-Related1
Not AvailableTerminatedTreatmentGlaucoma1
Not AvailableWithdrawnTreatmentMacular Edema (ME)1
Not AvailableWithdrawnTreatmentRetinopathy / Sickle Cell Anemia1
PharmacodynamicsRanibizumab is a recombinant humanized IgG1 kappa isotype monoclonal antibody fragment designed for intraocular use. Ranibizumab is a VEGF-A antagonist that binds to and inhibits the biologic activity of active forms of human VEGF-A, including the cleaved form (VEGF110). VEGF-A has been shown to cause neovascularization (angiogenesis) and an increase in vascular permeability, which is thought to contribute to the progression of the neovascular form of age-related macular degeneration (AMD).
Mechanism of actionRanibizumab binds to the receptor binding site of active forms of VEGF-A, including the biologically active, cleaved form of this molecule, VEGF110. The binding of ranibizumab to VEGF-A prevents the interaction of VEGF-A with its receptors (VEGFR1 and VEGFR2) on the surface of endothelial cells, reducing endothelial cell proliferation, vascular leakage, and new blood vessel formation.
TargetKindPharmacological actionActionsOrganismUniProt ID
Vascular endothelial growth factor AProteinyesNot AvailableHumanP15692 details
Related Articles
AbsorptionAfter monthly intravitreal injections, maximum serum concentrations are minimal around 0.3 ng/mL to 2.36 ng/mL.
Volume of distribution

Volume of distribution is insignificant.

Protein bindingPlasma protein binding is insignificant.
Metabolism

Metabolism was not quantified.

Route of eliminationNot Available
Half lifeApproximately 9 days.
Clearance

Clearance was not quantified.

ToxicityThe most common toxic effects to the eye are eye pain, vitreous floaters, increased intraocular pressure, conjunctival hemorrhage, intraocular inflammation, and foreign body sensation. Also arterial thromboembolic events have occurred in patients.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Ranibizumab.Approved
ALT-110The therapeutic efficacy of ALT-110 can be decreased when used in combination with Ranibizumab.Investigational
AnvirzelAnvirzel may decrease the cardiotoxic activities of Ranibizumab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Ranibizumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Ranibizumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Ranibizumab.Approved
CDX-110The therapeutic efficacy of CDX-110 can be decreased when used in combination with Ranibizumab.Investigational
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Ranibizumab.Approved, Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Ranibizumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Ranibizumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Ranibizumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Ranibizumab.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Ranibizumab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Ranibizumab.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Ranibizumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Ranibizumab.Investigational
OuabainOuabain may decrease the cardiotoxic activities of Ranibizumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Ranibizumab.Approved, Vet Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Ranibizumab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Ranibizumab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Ranibizumab.Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Ranibizumab.Approved, Investigational
Food Interactions
  • No food effects found.
References
Synthesis ReferenceNot Available
General References
  1. Gaudreault J, Fei D, Beyer JC, Ryan A, Rangell L, Shiu V, Damico LA: Pharmacokinetics and retinal distribution of ranibizumab, a humanized antibody fragment directed against VEGF-A, following intravitreal administration in rabbits. Retina. 2007 Nov-Dec;27(9):1260-6. [PubMed:18046235 ]
  2. Gaudreault J, Fei D, Rusit J, Suboc P, Shiu V: Preclinical pharmacokinetics of Ranibizumab (rhuFabV2) after a single intravitreal administration. Invest Ophthalmol Vis Sci. 2005 Feb;46(2):726-33. [PubMed:15671306 ]
  3. Bakri SJ, Snyder MR, Reid JM, Pulido JS, Ezzat MK, Singh RJ: Pharmacokinetics of intravitreal ranibizumab (Lucentis). Ophthalmology. 2007 Dec;114(12):2179-82. [PubMed:18054637 ]
  4. Kourlas H, Abrams P: Ranibizumab for the treatment of neovascular age-related macular degeneration: a review. Clin Ther. 2007 Sep;29(9):1850-61. [PubMed:18035187 ]
External Links
ATC CodesS01LA04
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelDownload (383 KB)
MSDSDownload (95.8 KB)
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravitreal10 mg/ml
Injection, solutionIntravitreal6 mg/mL
SolutionIntravitreal10 mg
Prices
Unit descriptionCostUnit
Lucentis 0.5 mg vial2340.0USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2286330 No2008-06-102018-04-03Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting pointNot applicableFrom MSDS.
boiling pointApproximately 100 degrees CFrom MSDS.
water solubilitySoluble in water.From MSDS.
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Vascular endothelial growth factor receptor binding
Specific Function:
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activ...
Gene Name:
VEGFA
Uniprot ID:
P15692
Molecular Weight:
27042.205 Da
References
  1. Gaudreault J, Fei D, Rusit J, Suboc P, Shiu V: Preclinical pharmacokinetics of Ranibizumab (rhuFabV2) after a single intravitreal administration. Invest Ophthalmol Vis Sci. 2005 Feb;46(2):726-33. [PubMed:15671306 ]
  2. Michels S, Rosenfeld PJ: [Treatment of neovascular age-related macular degeneration with Ranibizumab/Lucentis]. Klin Monbl Augenheilkd. 2005 Jun;222(6):480-4. [PubMed:15973626 ]
  3. Rosenfeld PJ, Rich RM, Lalwani GA: Ranibizumab: Phase III clinical trial results. Ophthalmol Clin North Am. 2006 Sep;19(3):361-72. [PubMed:16935211 ]
  4. Nguyen QD, Tatlipinar S, Shah SM, Haller JA, Quinlan E, Sung J, Zimmer-Galler I, Do DV, Campochiaro PA: Vascular endothelial growth factor is a critical stimulus for diabetic macular edema. Am J Ophthalmol. 2006 Dec;142(6):961-9. Epub 2006 Aug 2. [PubMed:17046701 ]
  5. Pieramici DJ, Avery RL: Ranibizumab: treatment in patients with neovascular age-related macular degeneration. Expert Opin Biol Ther. 2006 Nov;6(11):1237-45. [PubMed:17049020 ]
  6. Gaudreault J, Fei D, Beyer JC, Ryan A, Rangell L, Shiu V, Damico LA: Pharmacokinetics and retinal distribution of ranibizumab, a humanized antibody fragment directed against VEGF-A, following intravitreal administration in rabbits. Retina. 2007 Nov-Dec;27(9):1260-6. [PubMed:18046235 ]
  7. Ferrara N, Damico L, Shams N, Lowman H, Kim R: Development of ranibizumab, an anti-vascular endothelial growth factor antigen binding fragment, as therapy for neovascular age-related macular degeneration. Retina. 2006 Oct;26(8):859-70. [PubMed:17031284 ]
  8. Bakri SJ, Snyder MR, Reid JM, Pulido JS, Ezzat MK, Singh RJ: Pharmacokinetics of intravitreal ranibizumab (Lucentis). Ophthalmology. 2007 Dec;114(12):2179-82. [PubMed:18054637 ]
  9. Kourlas H, Abrams P: Ranibizumab for the treatment of neovascular age-related macular degeneration: a review. Clin Ther. 2007 Sep;29(9):1850-61. [PubMed:18035187 ]
  10. Spitzer MS, Ziemssen F, Bartz-Schmidt KU, Gelisken F, Szurman P: Treatment of age-related macular degeneration: focus on ranibizumab. Clin Ophthalmol. 2008 Mar;2(1):1-14. [PubMed:19668384 ]
Comments
comments powered by Disqus
Drug created on May 16, 2007 14:14 / Updated on August 17, 2016 12:23