Ranibizumab

Identification

Name
Ranibizumab
Accession Number
DB01270
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Ranibizumab is a recombinant humanized IgG1 kappa isotype monoclonal antibody fragment designed for intraocular use. Ranibizumab binds to and inhibits the biologic activity of human vascular endothelial growth factor A (VEGF-A). Ranibizumab has a molecular weight of approximately 48 kilodaltons and is produced by an E. coli expression system in a nutrient medium containing the antibiotic tetracycline (tetracycline is not detectable in the final product). Ranibizumab is marketed under the name Lucentis®. It is indicated for the treatment of macular edema after retinal vein occlusion, age-related macular degeneration (wet), and diabetic macular edema.

Protein structure
Db01270
Protein chemical formula
C2158H3282N562O681S12
Protein average weight
48349.611 Da
Sequences
>Ranibizumab Light Chain
DIQLTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Ranibizumab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPYYYGTSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHL
Download FASTA Format
Synonyms
  • rhuFab V2
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
LucentisSolution10 mgIntravitrealNovartis2007-07-26Not applicableCanada
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited2007-01-22Not applicableEu
LucentisInjection, solution10 mg/mLIntravitrealGenentech, Inc.2006-06-30Not applicableUs
LucentisSolution10 mgIntravitrealNovartis2014-09-18Not applicableCanada
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited2007-01-22Not applicableEu
LucentisInjection, solution6 mg/mLIntravitrealGenentech, Inc.2012-08-10Not applicableUs
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited2007-01-22Not applicableEu
LucentisInjection, solution10 mg/mlIntravitrealNovartis Europharm Limited2007-01-22Not applicableEu
Categories
UNII
ZL1R02VT79
CAS number
347396-82-1

Pharmacology

Indication

For the treatment of patients with macular edema after retinal vein occlusion, age-related macular degeneration (wet), and diabetic macular edema.

Structured Indications
Pharmacodynamics

Ranibizumab is a recombinant humanized IgG1 kappa isotype monoclonal antibody fragment designed for intraocular use. Ranibizumab is a VEGF-A antagonist that binds to and inhibits the biologic activity of active forms of human VEGF-A, including the cleaved form (VEGF110). VEGF-A has been shown to cause neovascularization (angiogenesis) and an increase in vascular permeability, which is thought to contribute to the progression of the neovascular form of age-related macular degeneration (AMD).

Mechanism of action

Ranibizumab binds to the receptor binding site of active forms of VEGF-A, including the biologically active, cleaved form of this molecule, VEGF110. The binding of ranibizumab to VEGF-A prevents the interaction of VEGF-A with its receptors (VEGFR1 and VEGFR2) on the surface of endothelial cells, reducing endothelial cell proliferation, vascular leakage, and new blood vessel formation.

TargetActionsOrganism
AVascular endothelial growth factor ANot AvailableHuman
Absorption

After monthly intravitreal injections, maximum serum concentrations are minimal around 0.3 ng/mL to 2.36 ng/mL.

Volume of distribution

Volume of distribution is insignificant.

Protein binding

Plasma protein binding is insignificant.

Metabolism

Metabolism was not quantified.

Route of elimination
Not Available
Half life

Approximately 9 days.

Clearance

Clearance was not quantified.

Toxicity

The most common toxic effects to the eye are eye pain, vitreous floaters, increased intraocular pressure, conjunctival hemorrhage, intraocular inflammation, and foreign body sensation. Also arterial thromboembolic events have occurred in patients.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Ranibizumab.Approved
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Ranibizumab.Experimental
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Ranibizumab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Ranibizumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Ranibizumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Ranibizumab.Approved
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Ranibizumab.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Ranibizumab.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Ranibizumab.Approved, Investigational
CymarinCymarin may decrease the cardiotoxic activities of Ranibizumab.Experimental
DeslanosideDeslanoside may decrease the cardiotoxic activities of Ranibizumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Ranibizumab.Approved, Investigational
DigoxinDigoxin may decrease the cardiotoxic activities of Ranibizumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Ranibizumab.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Ranibizumab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Ranibizumab.Investigational
GitoformateGitoformate may decrease the cardiotoxic activities of Ranibizumab.Experimental
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Ranibizumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Ranibizumab.Investigational
Lanatoside CLanatoside C may decrease the cardiotoxic activities of Ranibizumab.Experimental
MetildigoxinMetildigoxin may decrease the cardiotoxic activities of Ranibizumab.Experimental
OleandrinOleandrin may decrease the cardiotoxic activities of Ranibizumab.Experimental, Investigational
OuabainOuabain may decrease the cardiotoxic activities of Ranibizumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Ranibizumab.Approved, Vet Approved
PeruvosidePeruvoside may decrease the cardiotoxic activities of Ranibizumab.Experimental
ProscillaridinProscillaridin may decrease the cardiotoxic activities of Ranibizumab.Experimental
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Ranibizumab.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Ranibizumab.Investigational
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Ranibizumab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Ranibizumab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Ranibizumab.Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Ranibizumab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Ranibizumab.Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Ranibizumab.Approved, Investigational
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Ranibizumab.Approved
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Ranibizumab.Approved
Food Interactions
  • No food effects found.

References

General References
  1. Gaudreault J, Fei D, Beyer JC, Ryan A, Rangell L, Shiu V, Damico LA: Pharmacokinetics and retinal distribution of ranibizumab, a humanized antibody fragment directed against VEGF-A, following intravitreal administration in rabbits. Retina. 2007 Nov-Dec;27(9):1260-6. [PubMed:18046235]
  2. Gaudreault J, Fei D, Rusit J, Suboc P, Shiu V: Preclinical pharmacokinetics of Ranibizumab (rhuFabV2) after a single intravitreal administration. Invest Ophthalmol Vis Sci. 2005 Feb;46(2):726-33. [PubMed:15671306]
  3. Bakri SJ, Snyder MR, Reid JM, Pulido JS, Ezzat MK, Singh RJ: Pharmacokinetics of intravitreal ranibizumab (Lucentis). Ophthalmology. 2007 Dec;114(12):2179-82. [PubMed:18054637]
  4. Kourlas H, Abrams P: Ranibizumab for the treatment of neovascular age-related macular degeneration: a review. Clin Ther. 2007 Sep;29(9):1850-61. [PubMed:18035187]
External Links
KEGG Drug
D05697
PubChem Substance
46506960
ChEMBL
CHEMBL1201825
Therapeutic Targets Database
DAP001260
PharmGKB
PA164746012
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Ranibizumab
ATC Codes
S01LA04 — Ranibizumab
AHFS Codes
  • 52:92.00 — EENT Drugs, Miscellaneous
FDA label
Download (383 KB)
MSDS
Download (95.8 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
0CompletedTreatmentCutaneous Neurofibromas / Neurofibromatosis Type 11
1Active Not RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
1CompletedTreatmentAge-Related Macular Degeneration (AMD)1
1CompletedTreatmentCentral Retinal Vein Occlusion (CRVO)2
1CompletedTreatmentCentral Serous Chorioretinopathy (CSC)1
1CompletedTreatmentChoroidal Melanoma1
1CompletedTreatmentChoroidal Melanoma / Radiation Retinopathy1
1CompletedTreatmentConjunctival Neoplasms1
1CompletedTreatmentCorneal Neovascularization2
1CompletedTreatmentEye Diseases / Macular Degeneration / Neovascularization, Pathologic / Retinal Degenerations / Retinal Diseases1
1CompletedTreatmentFailing Bleb Following Trabeculectomy / Open-angle Glaucoma (OAG)1
1CompletedTreatmentIris Neovascularization / Proliferative Diabetic Retinopathy (PDR)1
1CompletedTreatmentIschemic Central Retinal Vein Occlusion1
1CompletedTreatmentMacular Telangiectasia1
1CompletedTreatmentMyopia, Degenerative1
1CompletedTreatmentNeovascularization1
1CompletedTreatmentNonarteritic Anterior Ischemic Optic Neuropathy1
1CompletedTreatmentPterygium2
1CompletedTreatmentRadiation Retinopathy1
1CompletedTreatmentRetinal Pigment Epithelial Detachment1
1CompletedTreatmentRetinal Vein Occlusions(RVO)1
1CompletedTreatmentSubfoveal Choroidal Neovascularization2
1CompletedTreatmentTelangiectasias3
1CompletedTreatmentUveitic Cystoid Macular Edema1
1CompletedTreatmentVon Hippel-Lindau Syndrome1
1RecruitingTreatmentCystoid Macular Edema1
1RecruitingTreatmentDiabetic Macular Edema (DME) / Neovascular Age-Related Macular Degeneration1
1RecruitingTreatmentWet Age-Related Macular Degeneration1
1TerminatedTreatmentEye Diseases / Pathologic Processes / Retinal Diseases / Retinal Vein Occlusions(RVO) / Transient ischemia attacks1
1Unknown StatusTreatmentAge-Related Macular Degeneration (ARMD)1
1Unknown StatusTreatmentCentral Retinal Vein Occlusion (CRVO) / Depressive State / Retinal Vein Occlusions(RVO) / Venous Retinal Branch Occlusion1
1WithdrawnTreatmentAge Related Macular Degeneration (ARMD) / AMD / CNV1
1WithdrawnTreatmentDiabetic Macular Edema (DME)2
1WithdrawnTreatmentHereditary Haemorrhagic Telangiectasia (HHT) / Nasal Bleeding1
1WithdrawnTreatmentPort-wine Stains (PWS)1
1, 2Active Not RecruitingPreventionAge-Related Macular Degeneration (ARMD)1
1, 2Active Not RecruitingTreatmentDiabetic Macular Edema (DME)3
1, 2CompletedBasic ScienceAge-Related Macular Degeneration (ARMD) / Diabetic Macular Edema (DME) / Retinal Vein Occlusions(RVO)1
1, 2CompletedSupportive CareNeovascular Age-Related Macular Degeneration1
1, 2CompletedTreatmentAge Related Macular Degeneration (AMD)1
1, 2CompletedTreatmentAge Related Macular Degeneration (ARMD)1
1, 2CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
1, 2CompletedTreatmentBEST VITELLIFORM MACULAR DYSTROPHY, MULTIFOCAL (Disorder) / Idiopathic Retinal Telangiectasia / Iris Neovascularization / Multi-focal Choroiditis / Pathological Myopia / Polypoidal Choroidal Vasculopathy (PCV) / Pseudoxanthoma Elasticum / Retinal Angiomatous Proliferation / Retinal Telangiectasis / Von Hippel Lindau Disease1
1, 2CompletedTreatmentBranch Retinal Vein Occlusion / Central Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
1, 2CompletedTreatmentCardiovascular Disease (CVD) / Diabetic Angiopathies / Eye Diseases / Retinal Diseases / Retinopathy, Diabetic / Vascular Diseases1
1, 2CompletedTreatmentChronic Central Serous Chorioretinopathy1
1, 2CompletedTreatmentClinically Significant Diabetic Macular Edema1
1, 2CompletedTreatmentCytoid Macular Edema / Uveitis1
1, 2CompletedTreatmentDiabetic Macular Edema (DME)1
1, 2CompletedTreatmentExudative Macular Degeneration1
1, 2CompletedTreatmentGlaucoma / Trabeculectomy1
1, 2CompletedTreatmentMacular Degeneration2
1, 2CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
1, 2CompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusions(RVO)1
1, 2CompletedTreatmentMaculopathies, Age-Related1
1, 2CompletedTreatmentNeovascular Age-Related Macular Degeneration2
1, 2CompletedTreatmentPCV / Polypoidal Choroidal Vasculopathy (PCV)1
1, 2CompletedTreatmentPolypoidal Choroidal Vasculopathy (PCV)1
1, 2CompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
1, 2CompletedTreatmentRetinal Vein Occlusions(RVO)1
1, 2CompletedTreatmentSubfoveal Choroidal Neovascularization(CNV) Secondary to Age-related Macular Degeneration (AMD)1
1, 2RecruitingPreventionAge-Related Macular Degeneration (ARMD)1
1, 2RecruitingTreatmentDiabetic Macular Edema (DME) / Hard Lipid Exudates1
1, 2RecruitingTreatmentVon Hippel-Lindau Syndrome1
1, 2TerminatedTreatmentAge Related Macular Degeneration (ARMD) / Choroidal Neovascular Membrane / Macular Degeneration / Subfoveal Neovascular Age-Related Macular Degeneration / Wet Age-Related Macular Degeneration1
1, 2TerminatedTreatmentAge-Related Macular Degeneration (AMD)1
1, 2Unknown StatusTreatmentDiabetic Macular Edema (DME)1
1, 2Unknown StatusTreatmentOcular Histoplasmosis Syndrome1
1, 2Unknown StatusTreatmentPolypoidal Choroidal Vasculopathy (PCV)2
1, 2Unknown StatusTreatmentProliferative Diabetic Retinopathy (PDR)1
1, 2Unknown StatusTreatmentRecalcitrant Wet Age-related Macular Degeneration1
1, 2WithdrawnTreatmentAngioid Streaks1
1, 2WithdrawnTreatmentGlaucoma / Glaucoma, Neovascular / New Onset Glaucoma / New Onset Neovascular Glaucoma1
2Active Not RecruitingTreatmentAge-Related Macular Degeneration (AMD) / AMD / Eye Diseases / Macular Degeneration / Macular Degeneration, Age-related, 10 / Neovascular Age-Related Macular Degeneration / Retinal Degenerations / Retinal Diseases1
2Active Not RecruitingTreatmentDiabetic Macular Edema (DME)1
2Active Not RecruitingTreatmentMacular Degeneration, Age-Related / Subfoveal Choroidal Neovascularization1
2Active Not RecruitingTreatmentMacular Degeneration, Choroidal Neovascularization / Subfoveal Choroidal Neovascularization1
2CompletedNot AvailableWet AMD1
2CompletedTreatmentAge Related Macular Degeneration (ARMD)5
2CompletedTreatmentAge-Related Macular Degeneration (ARMD)3
2CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentBranch Retinal Vein Occlusion / Macular Edema (ME)1
2CompletedTreatmentChoroidal Melanoma1
2CompletedTreatmentChoroidal Neovascularisation1
2CompletedTreatmentDiabetes Mellitus (DM) / Diabetic Macular Edema (DME)1
2CompletedTreatmentDiabetic Macular Edema (DME)8
2CompletedTreatmentDiabetic Macular Edema (DME) / Retinopathy, Diabetic1
2CompletedTreatmentDiabetic Macular Edema (DME) / Retinopathy, Diabetic / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentDiabetic Macular Edema (DME) / Visual Impairment1
2CompletedTreatmentIdiopathic Polypoidal Choroidal Vasculopathy1
2CompletedTreatmentMacular Degeneration4
2CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentMacular Edema (ME)2
2CompletedTreatmentMacular Edema (ME) / Retinopathy, Diabetic1
2CompletedTreatmentMaculopathies, Age-Related / Subfoveal Choroidal Neovascularization2
2CompletedTreatmentNeovascular Age Related Macular Degeneration1
2CompletedTreatmentNeovascular Age-Related Macular Degeneration6
2CompletedTreatmentPigment Epithelial Detachment1
2CompletedTreatmentPosterior Vitreous Detachment / Retinal Vein Occlusions(RVO)1
2CompletedTreatmentRetinal Detachment / Retinopathy, Diabetic1
2CompletedTreatmentRetinal Diseases / Telangiectasias1
2CompletedTreatmentRetinal Neovascularization / Retinopathy, Diabetic1
2CompletedTreatmentRetinopathy of Prematurity (ROP)1
2CompletedTreatmentSteroid-induced Glaucoma - Borderline / Uveitis Related Cystoid Macular Edema1
2CompletedTreatmentSubfoveal Choroidal Neovascularization1
2CompletedTreatmentType 2 Idiopathic Macular Telangiectasia1
2Not Yet RecruitingTreatmentDiabetic Macular Edema (DME)1
2Not Yet RecruitingTreatmentExudative Age Related Macular Degeneration1
2RecruitingBasic ScienceGlaucoma, Neovascular / Macular Degeneration / Macular Hole / Proliferative Diabetic Retinopathy (PDR)1
2RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
2RecruitingTreatmentMacular Degeneration1
2RecruitingTreatmentRadiation Retinopathy1
2RecruitingTreatmentWet Macular Degeneration1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD)1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD) / Choroid Neovascularization1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD) / Choroidal Neo-Vascular Age-onset Macular Degeneration1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
2TerminatedTreatmentDiabetic Macular Edema (DME)1
2TerminatedTreatmentMacular Degeneration1
2TerminatedTreatmentMacular Degeneration / Pigment Epithelium of Eye / Retinal Detachment / Retinal Pigment Epithelial Detachment / Wet Macular Degeneration1
2TerminatedTreatmentMacular Edema (ME) / Proliferative Diabetic Retinopathy (PDR)1
2TerminatedTreatmentMaculopathies, Age-Related / Subfoveal Choroidal Neovascularization1
2Unknown StatusTreatmentBranch Retinal Vein Occlusion1
2Unknown StatusTreatmentDiabetic Macular Edema (DME)2
2Unknown StatusTreatmentMacular Edema (ME) / Retinal Vein Occlusions(RVO)1
2Unknown StatusTreatmentMacular Edema (ME) / Retinopathy, Diabetic1
2Unknown StatusTreatmentPresumed Ocular Histoplasmosis (POHS)1
2Unknown StatusTreatmentRetinoblastoma1
2Unknown StatusTreatmentRetinopathy, Diabetic1
2Unknown StatusTreatmentWet Macular Degeneration1
2WithdrawnTreatmentAge Related Macular Degeneration (ARMD)1
2WithdrawnTreatmentAge-Related Macular Degeneration (ARMD)1
2WithdrawnTreatmentDiabetic Macular Edema (DME)1
2WithdrawnTreatmentMacular Edema (ME) / Uveitis1
2WithdrawnTreatmentPersistent Diabetic Macular Edema1
2, 3CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Neovascular Macular Degeneration / Pigment Epithelial Detachment / Wet Macular Degeneration1
2, 3CompletedTreatmentEales' Disease1
2, 3CompletedTreatmentGlaucoma1
2, 3CompletedTreatmentProliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
2, 3CompletedTreatmentPterygium1
2, 3RecruitingBasic ScienceAge Related Macular Degeneration (ARMD)1
2, 3RecruitingTreatmentDiabetic Macular Edema (DME)1
2, 3RecruitingTreatmentExudative Macular Degeneration / Retinal Hemorrhage1
2, 3RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
2, 3RecruitingTreatmentRetinal Vein Occlusions(RVO)1
2, 3TerminatedTreatmentAge-Related Macular Degeneration (ARMD)1
2, 3TerminatedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
2, 3Unknown StatusTreatmentDiabetes Complications1
2, 3Unknown StatusTreatmentDiabetic Macular Edema (DME)1
2, 3Unknown StatusTreatmentUveal Melanoma1
3Active Not RecruitingTreatmentAge Related Macular Degeneration (ARMD)1
3Active Not RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
3Active Not RecruitingTreatmentMacular Degeneration2
3Active Not RecruitingTreatmentRetinopathy of Prematurity1
3CompletedNot AvailableDiabetic Macular Edema (DME)1
3CompletedNot AvailableNeovascular Age-Related Macular Degeneration1
3CompletedSupportive CareAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentAge Related Macular Degeneration (ARMD)3
3CompletedTreatmentAge Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
3CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization3
3CompletedTreatmentBranch Retinal Vein Occlusion3
3CompletedTreatmentBranch Retinal Vein Occlusion / Macular Edema (ME) / Visual Impairment1
3CompletedTreatmentCentral Retinal Vein Occlusion (CRVO)1
3CompletedTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME)2
3CompletedTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME) / Visual Impairment1
3CompletedTreatmentChoroidal Melanoma1
3CompletedTreatmentChoroidal Neovascularization (CNV)1
3CompletedTreatmentChoroidal Neovascularization Secondary to Pathologic Myopia1
3CompletedTreatmentDiabetes Mellitus (DM) / Macular Edema (ME)2
3CompletedTreatmentDiabetic Macular Edema (DME)5
3CompletedTreatmentDiabetic Macular Edema (DME) / Proliferative Diabetic Retinopathy (PDR)1
3CompletedTreatmentDiabetic Macular Edema (DME) / Proliferative Diabetic Retinopathy (PDR) / Retinopathy, Diabetic1
3CompletedTreatmentDiabetic Macular Edema (DME) / Retinopathy, Diabetic1
3CompletedTreatmentDiabetic Macular Edema (DME) / Vision Impairment Due to Diabetic Macular Edema / Visual Impairment1
3CompletedTreatmentGlaucoma, Neovascular / Macular Edema (ME) / Retinopathy, Diabetic / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentGlaucoma / Iris Neovascularization1
3CompletedTreatmentMacular Degeneration8
3CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentMacular Edema (ME)1
3CompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusions(RVO)3
3CompletedTreatmentNeovascular Age-Related Macular Degeneration1
3CompletedTreatmentPathological Myopia1
3CompletedTreatmentRetinal Vein Occlusions(RVO)2
3CompletedTreatmentVisual Impairment Due to Choroidal Neovascularization Secondary to Pathologic Myopia1
3Not Yet RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
3Not Yet RecruitingTreatmentGlaucoma, Neovascular / Ranibizumab1
3RecruitingPreventionProliferative Diabetic Retinopathy (PDR)1
3RecruitingTreatmentAge-Related Macular Degeneration (AMD)1
3RecruitingTreatmentMacular Edema (ME) / Uveitis1
3RecruitingTreatmentNeovascular (Wet) Age-related Macular Degeneration (AMD)1
3RecruitingTreatmentRetinopathy of Prematurity1
3TerminatedTreatmentAge-Related Macular Degeneration (ARMD)2
3TerminatedTreatmentMacular Degeneration1
3TerminatedTreatmentNeovascular Age-Related Macular Degeneration1
3TerminatedTreatmentVisual Impairment Due to Diabetic Macular Edema1
3Unknown StatusTreatmentAge Related Macular Degeneration (ARMD)3
3Unknown StatusTreatmentAge-Related Neovascular Macular Degeneration1
3Unknown StatusTreatmentBranch Retinal Vein Occlusion1
3Unknown StatusTreatmentMacular Degeneration1
3Unknown StatusTreatmentProliferative Diabetic Retinopathy (PDR)1
3WithdrawnTreatmentAge Related Macular Degeneration (ARMD)1
3WithdrawnTreatmentWet Age-Related Macular Degeneration1
4Active Not RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
4Active Not RecruitingTreatmentBranch Retinal Vein Occlusion / Macular Edema (ME)1
4Active Not RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)1
4Active Not RecruitingTreatmentDiabetic Macular Edema (DME)1
4Active Not RecruitingTreatmentMacular Degeneration1
4Active Not RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
4Active Not RecruitingTreatmentSubfoveal Choroidal Neovascularization (CNV) Secondary to Wet Age-related Macular Degeneration (AMD)1
4CompletedNot AvailableMacular Degeneration1
4CompletedBasic ScienceAge-Related Macular Degeneration (ARMD)1
4CompletedTreatmentAge Related Macular Degeneration (ARMD)1
4CompletedTreatmentAge Related Macular Degeneration (ARMD) / Efficacy and Safety of Ranibizumab (Lucentis) / Retinal Vein Occlusions(RVO)1
4CompletedTreatmentAge-Related Macular Degeneration (ARMD)3
4CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Age-related Macular Degeneration; Polypoidal Choroidal Vasculopathy (PCV) / Polypoidal Choroidal Vasculopathy PCV1
4CompletedTreatmentCentral Retinal Vein Occlusion (CRVO)1
4CompletedTreatmentCentral Retinal, Hemi Retinal & Brach Retinal Vein Occlusions1
4CompletedTreatmentDiabetic Macular Edema (DME)1
4CompletedTreatmentGlaucoma, Neovascular / Retinopathy, Diabetic1
4CompletedTreatmentMacular Degeneration2
4CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
4CompletedTreatmentMacular Edema (ME)2
4CompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusions(RVO)1
4CompletedTreatmentMacular Edema (ME) / Visual Impairment1
4CompletedTreatmentMacular Oedema / Retinopathy, Diabetic1
4CompletedTreatmentMaculopathies, Age-Related / Subfoveal Choroidal Neovascularization1
4CompletedTreatmentNeovascular Age Related Macular Degeneration1
4CompletedTreatmentNeovascular Age-Related Macular Degeneration5
4CompletedTreatmentPigment Epithelial Detachment1
4CompletedTreatmentPolypoidal Choroidal Vasculopathy (PCV)1
4CompletedTreatmentRetinal Diseases1
4CompletedTreatmentRetinal Pigment Epithelial Detachment / Subfoveal Choroidal Neovascularization1
4CompletedTreatmentRetinal Vein Occlusions(RVO)2
4CompletedTreatmentRetinopathy, Diabetic2
4CompletedTreatmentSecondary to Age-related Macular Degeneration (AMD) / Subfoveal Choroidal Neovascularization (CNV)1
4CompletedTreatmentVisual Impairment Due to Neovascular AMD1
4CompletedTreatmentWet Age Related Macular Degeneration1
4CompletedTreatmentWet Macular Degeneration1
4Enrolling by InvitationTreatmentDiabetic Macular Edema (DME)1
4Not Yet RecruitingNot AvailableAge-Related Macular Degeneration (ARMD)2
4Not Yet RecruitingBasic ScienceNeovascular Age-Related Macular Degeneration / Polypoidal Choroidal Vasculopathy (PCV)1
4Not Yet RecruitingTreatmentCentral Retinal Vein Occlusion With Macular Edema1
4RecruitingBasic ScienceDiabetic Macular Edema (DME)1
4RecruitingBasic ScienceNeovascular Age-Related Macular Degeneration1
4RecruitingOtherEye Diseases / Premature Births / Retinal Diseases / Retinopathy of Prematurity Both Eyes / Type 1 Retinopathy of Prematurity Both Eyes1
4RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
4RecruitingTreatmentBranch Retinal Vein Occlusion2
4RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
4RecruitingTreatmentDiabetic Macular Edema (DME)2
4RecruitingTreatmentMacular Diseases1
4RecruitingTreatmentMacular Edema Secondary to Branch Retinal Vein Occlusion (BRVO)1
4RecruitingTreatmentMacular Edema, Cystoid / Visual Acuity Reduced Transiently1
4RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
4RecruitingTreatmentWet Macular Degeneration2
4TerminatedScreeningAge-Related Macular Degeneration (ARMD) / Cerebrovascular Disorders / Coronary Artery Disease1
4TerminatedTreatmentAge-Related Macular Degeneration (ARMD)1
4Unknown StatusPreventionRadiation Maculopathy / Radiation Retinopathy / Uveal Melanoma1
4Unknown StatusSupportive CareDegeneration of Macula and Posterior Pole1
4Unknown StatusTreatmentDiabetic Macular Edema (DME)1
4Unknown StatusTreatmentMacular Degeneration / Visual Acuity1
4Unknown StatusTreatmentMyopic Choroidal Neovascularization1
4Unknown StatusTreatmentRetinal Neovascularisation / Retinopathy, Diabetic1
4WithdrawnTreatmentVisual Impairment Due to Diabetic Macular Edema2
4WithdrawnTreatmentWet Age-related Macular Degeneration (Wet AMD)1
Not AvailableActive Not RecruitingNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableActive Not RecruitingNot AvailableDiabetic Macular Edema (DME)1
Not AvailableCompletedNot AvailableAMD1
Not AvailableCompletedNot AvailableAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedNot AvailableDiabetic Macular Edema (DME) / Retinal Vein Occlusions(RVO) / Wet Age Related Macular Degeneration / Wet Age Related Macular Degeneration, Diabetic Macular Edema, Retinal Vein Occlusion1
Not AvailableCompletedNot AvailableMacular Degeneration1
Not AvailableCompletedNot AvailableMacular Degeneration / Macular Edema (ME) / Ophthalmology1
Not AvailableCompletedNot AvailableMacular Edema (ME) / Retinal Vein Occlusions(RVO)1
Not AvailableCompletedNot AvailableOphthalmology, Macular Degeneration1
Not AvailableCompletedNot AvailableSubfoveal Choroidal Neovascularization1
Not AvailableCompletedDiagnosticAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedDiagnosticAge-Related Macular Degeneration (ARMD) / Retinal Function1
Not AvailableCompletedHealth Services ResearchDiabetic Macular Edema (DME) / Exudative Macular Degeneration1
Not AvailableCompletedTreatmentAge Related Macular Degeneration (ARMD)1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD) / Central Retinal Vein Occlusion (CRVO) / Diabetic Macular Edema (DME)1
Not AvailableCompletedTreatmentChoroidal Neovascularization, Age-related Macular Degeneration1
Not AvailableCompletedTreatmentEpiretinal Membrane1
Not AvailableCompletedTreatmentGlaucoma1
Not AvailableCompletedTreatmentGlaucoma, Neovascular / Rubeosis1
Not AvailableCompletedTreatmentMacular Edema (ME)1
Not AvailableCompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusions(RVO)2
Not AvailableCompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
Not AvailableCompletedTreatmentResearcher-Subject Relations1
Not AvailableCompletedTreatmentRetinopathy of Prematurity1
Not AvailableNot Yet RecruitingHealth Services ResearchInfant, Premature, Diseases1
Not AvailableNot Yet RecruitingTreatmentBranch Retinal Vein Occlusion / Laser Photocoagulation / Ranibizumab1
Not AvailableRecruitingNot AvailableDiabetic Macular Edema (DME)1
Not AvailableRecruitingNot AvailableMacular Diseases1
Not AvailableRecruitingTreatmentAge Related Macular Degeneration (ARMD)1
Not AvailableRecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
Not AvailableRecruitingTreatmentDiabetic Macular Edema (DME)1
Not AvailableTerminatedNot AvailableMaculopathies, Age-Related1
Not AvailableTerminatedTreatmentGlaucoma1
Not AvailableUnknown StatusNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableUnknown StatusNot AvailableAge-Related Macular Degeneration (ARMD)1
Not AvailableUnknown StatusNot AvailableAge-Related Macular Degeneration (ARMD) / Dry Macular Degeneration1
Not AvailableUnknown StatusNot AvailableMacular Edema (ME)1
Not AvailableUnknown StatusNot AvailableNeovascular Age Related Macular Degeneration1
Not AvailableUnknown StatusTreatmentAge Related Macular Degeneration (ARMD) / Retinal Pigment Epithelial Detachment With Vascularization1
Not AvailableUnknown StatusTreatmentAge-Related Macular Degeneration (ARMD)2
Not AvailableUnknown StatusTreatmentBranch Retinal Vein Occlusion / Central Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
Not AvailableUnknown StatusTreatmentCentral Retinal Vein Occlusion (CRVO)1
Not AvailableUnknown StatusTreatmentNeovascular Age-Related Macular Degeneration1
Not AvailableUnknown StatusTreatmentRetinal Vein Occlusions(RVO)1
Not AvailableUnknown StatusTreatmentVisual Disorder Due to Age-related Macula Degeneration1
Not AvailableWithdrawnTreatmentMacular Edema (ME)1
Not AvailableWithdrawnTreatmentRetinal Disorders / Sickle Cell Disorders1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravitreal10 mg/ml
Injection, solutionIntravitreal6 mg/mL
SolutionIntravitreal10 mg
Prices
Unit descriptionCostUnit
Lucentis 0.5 mg vial2340.0USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2286330No2008-06-102018-04-03Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)Not applicableFrom MSDS.
boiling point (°C)Approximately 100 degrees CFrom MSDS.
water solubilitySoluble in water.From MSDS.

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
General Function
Vascular endothelial growth factor receptor binding
Specific Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of...
Gene Name
VEGFA
Uniprot ID
P15692
Uniprot Name
Vascular endothelial growth factor A
Molecular Weight
27042.205 Da
References
  1. Gaudreault J, Fei D, Rusit J, Suboc P, Shiu V: Preclinical pharmacokinetics of Ranibizumab (rhuFabV2) after a single intravitreal administration. Invest Ophthalmol Vis Sci. 2005 Feb;46(2):726-33. [PubMed:15671306]
  2. Michels S, Rosenfeld PJ: [Treatment of neovascular age-related macular degeneration with Ranibizumab/Lucentis]. Klin Monbl Augenheilkd. 2005 Jun;222(6):480-4. [PubMed:15973626]
  3. Rosenfeld PJ, Rich RM, Lalwani GA: Ranibizumab: Phase III clinical trial results. Ophthalmol Clin North Am. 2006 Sep;19(3):361-72. [PubMed:16935211]
  4. Nguyen QD, Tatlipinar S, Shah SM, Haller JA, Quinlan E, Sung J, Zimmer-Galler I, Do DV, Campochiaro PA: Vascular endothelial growth factor is a critical stimulus for diabetic macular edema. Am J Ophthalmol. 2006 Dec;142(6):961-9. Epub 2006 Aug 2. [PubMed:17046701]
  5. Pieramici DJ, Avery RL: Ranibizumab: treatment in patients with neovascular age-related macular degeneration. Expert Opin Biol Ther. 2006 Nov;6(11):1237-45. [PubMed:17049020]
  6. Gaudreault J, Fei D, Beyer JC, Ryan A, Rangell L, Shiu V, Damico LA: Pharmacokinetics and retinal distribution of ranibizumab, a humanized antibody fragment directed against VEGF-A, following intravitreal administration in rabbits. Retina. 2007 Nov-Dec;27(9):1260-6. [PubMed:18046235]
  7. Ferrara N, Damico L, Shams N, Lowman H, Kim R: Development of ranibizumab, an anti-vascular endothelial growth factor antigen binding fragment, as therapy for neovascular age-related macular degeneration. Retina. 2006 Oct;26(8):859-70. [PubMed:17031284]
  8. Bakri SJ, Snyder MR, Reid JM, Pulido JS, Ezzat MK, Singh RJ: Pharmacokinetics of intravitreal ranibizumab (Lucentis). Ophthalmology. 2007 Dec;114(12):2179-82. [PubMed:18054637]
  9. Kourlas H, Abrams P: Ranibizumab for the treatment of neovascular age-related macular degeneration: a review. Clin Ther. 2007 Sep;29(9):1850-61. [PubMed:18035187]
  10. Spitzer MS, Ziemssen F, Bartz-Schmidt KU, Gelisken F, Szurman P: Treatment of age-related macular degeneration: focus on ranibizumab. Clin Ophthalmol. 2008 Mar;2(1):1-14. [PubMed:19668384]

Drug created on May 16, 2007 14:14 / Updated on November 13, 2017 21:49