Bavituximab

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
Bavituximab
Accession Number
DB05136
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Bavituximab is a chimeric Anti-PS monoclonal antibody analog which is used to potentially treat cancers and viral infections. It binds to phosphatidylserine and other exposed host cell lipids when induced by cellular stress. Additional analogs in the class include 3G4, 2aG4, 9d2 and Hu3g4.

Protein structure
Db05136
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>8734_H|bavituximab|||H-GAMMA-1 (VH(1-120)+CH1(121-218)+HINGE-REGION(219-233)+CH2(234-343)+CH3(344-450))|||||||450||||MW 49410.6|MW 49410.6|
EVQLQQSGPELEKPGASVKLSCKASGYSFTGYNMNWVKQSHGKSLEWIGHIDPYYGDTSY
NQKFRGKATLTVDKSSSTAYMQLKSLTSEDSAVYYCVKGGYYGHWYFDVWGAGTTVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8734_L|bavituximab|||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-208))|||||||208||||MW 22655.0|MW 22655.0|
DIQMTQSPSSLSASLGERVSLTCRASQDIGSSLNWLQQGPDGTIKRLIYATSSLDSGVPK
RFSGSRSGSDYSLTISSLESEDFVDYYCLQYVSSPPTFGAGTKLELKRADAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSKADY
EKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
International/Other Brands
Tarvacin
Categories
UNII
Q16CT95N25
CAS number
648904-28-3

Pharmacology

Indication

Investigated for use/treatment in breast cancer, cancer/tumors (unspecified), HIV infection, hepatitis (viral, C), and solid tumors.

Pharmacodynamics
Not Available
Mechanism of action

Bavituximab Anti-Cancer is a monoclonal antibody that binds to a basic component of the cell structure called a phospholipid that is exposed only on the surface of tumor blood vessel cells or on cells infected with certain viruses. Bavituximab binding to the tumor blood vessel cells alerts the body’s immune system to attack the tumor and its blood supply. This has been shown to inhibit tumor growth and development. Because in healthy cells the phospholipids are concealed inside the cell, the bavituximab does not bind to them. This targets the bavituximab to the malignant cells and potentially minimizes unwanted side effects.

Bavituximab Anti-Viral represents a unique approach to treating viral diseases by recognizing features found only on infected cells and enveloped viruses. Bavituximab is a monoclonal antibody that binds to a basic component of the cell structure called an aminophospholipid that is exposed on the surface of cells only when they are infected with certain viruses or when they are malignant. After binding to these infected cells, the drug alerts the body’s immune system to attack the infected cells. This makes infected cells particularly susceptible to bavituximab treatment, while potentially sparing healthy cells. Also, bavituximab binds to phospholipids which are derived from the host (human) cell and not the virus, which indicates it may not be susceptible to viral drug resistance. In addition to treating an active illness, bavituximab may also confer long-term immunity. Bavituximab induces a pro-inflammatory cytokine profile, defined as an increase in the ratio of TNF alpha and TGF beta. Stimulating an immune response is a key proposed anti-viral mechanism of action of bavituximab.

Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

30 Hrs

Clearance
Not Available
Toxicity

Direct clearance of free virus and antibody-dependent cellular cytotoxicity of virus-infected cells appear to be the major mechanisms that contribute to the anti-viral effect of bavituximab

Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bavituximab.
AbituzumabThe risk or severity of adverse effects can be increased when Bavituximab is combined with Abituzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Bavituximab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Bavituximab.
AducanumabThe risk or severity of adverse effects can be increased when Bavituximab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Bavituximab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Bavituximab.
AlirocumabThe risk or severity of adverse effects can be increased when Bavituximab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Bavituximab is combined with Amatuximab.
AMG 108The risk or severity of adverse effects can be increased when Bavituximab is combined with AMG 108.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Evidence Level

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. He J, Luster TA, Thorpe PE: Radiation-enhanced vascular targeting of human lung cancers in mice with a monoclonal antibody that binds anionic phospholipids. Clin Cancer Res. 2007 Sep 1;13(17):5211-8. [PubMed:17785577]
External Links
PubChem Substance
347909970
Wikipedia
Bavituximab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentHER2-Negative Breast Cancer / Human Epidermal Growth Factor 2 Negative Carcinoma of Breast / Male Breast Cancer / Recurrent Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1CompletedTreatmentHepatitis C Viral Infection2
1CompletedTreatmentHepatitis C Virus (HCV) Infection / Human Immunodeficiency Virus (HIV) Infections1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1CompletedTreatmentRectal Adenocarcinoma1
1CompletedTreatmentTumors1
1WithdrawnTreatmentHepatocellular,Carcinoma / Liver Cancer / Unresectable Hepatocellular Carcinoma1
1, 2CompletedTreatmentHepatitis C Viral Infection1
1, 2CompletedTreatmentHepatocellular,Carcinoma / Liver Cancer1
2Active Not RecruitingTreatmentGlioblastomas1
2CompletedTreatmentBreast Cancer Metastatic1
2CompletedTreatmentCancer, Breast1
2CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer1
2CompletedTreatmentPancreatic Cancer Metastatic1
2RecruitingTreatmentHepatocellular,Carcinoma1
2WithdrawnTreatmentCancer, Breast / ER-Negative PR-Negative HER2-Negative Breast Cancer / ER-Negative PR-Negative HER2-Negative Breast Neoplasms / Triple Negative Breast Cancer (TNBC) / Triple Negative Breast Neoplasms / Triple-Negative Breast Cancer (TNBC) / Triple-Negative Breast Neoplasms1
2WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2, 3SuspendedTreatmentMetastatic Breast Cancer (MBC)1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Small-Cell Lung Cancer Metastatic / Non-Small-Cell Lung Cancer Stage IIIB / Non-Small-Cell Lung Cancer Stage IV1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Drug created on October 21, 2007 16:23 / Updated on May 01, 2019 09:53