Identification
NameBriakinumab
Accession NumberDB05459
TypeBiotech
GroupsInvestigational
Description

Briakinumab is a human anti-IL-12 monoclonal antibody being developed for the treatment of a number of T-cell driven autoimmune diseases. It targets and neutralize interleukin-12 and interleukin-23, two proteins associated with inflammation, such as pro-inflammatory interleukins or tumor necrosis factor- alpha. Briakinumab represents a novel approach to treating psoriasis, Multiple Sclerosis, Crohn’s Disease and other autoimmune and inflammatory disorders. As of 2011 drug development for psoriasis has been discontinued in the U.S. and Europe.

Protein structureNo structure small
Related Articles
Protein chemical formulaC6376H9874N1722O1992S44
Protein average weight146500.0 Da
Sequences
>P42701|I12R1_HUMAN Interleukin-12 receptor beta-1 chain precursor - Homo sapiens
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKA
KM
>Q9NPF7|IL23A_HUMAN Interleukin-23 subunit alpha precursor - Homo sapiens
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
Download FASTA Format
SynonymsNot Available
External IDs ABT-874
Product Ingredients Not Available
Approved Prescription ProductsNot Available
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNII978I8M0P8X
CAS number339308-60-0
Pharmacology
Indication

Investigated for use/treatment in autoimmune diseases, crohn's disease, multiple sclerosis, psoriasis and psoriatic disorders, and rheumatoid arthritis.

Structured Indications Not Available
Pharmacodynamics

Briakinumab is a human anti-IL-12 monoclonal antibody being developed for the treatment of a number of T-cell driven autoimmune diseases. It targets and neutralizes interleukin-12 and interleukin-23, two proteins associated with inflammation.

Mechanism of action

Briakinumab targets and neutralizes interleukin-12 and interleukin-23.

TargetKindPharmacological actionActionsOrganismUniProt ID
Interleukin-12 subunit betaProteinunknownNot AvailableHumanP29460 details
Interleukin-23 subunit alphaProteinunknownNot AvailableHumanQ9NPF7 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein binding

It targets and neutralize interleukin-12 and interleukin-23, two proteins associated with inflammation in psoriasis and other autoimmune disorders.

MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organismsNot Available
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Briakinumab.Approved
FingolimodBriakinumab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Briakinumab is combined with G17DT.Investigational
INGN 201The risk or severity of adverse effects can be increased when Briakinumab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Briakinumab is combined with INGN 225.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Briakinumab is combined with Leflunomide.Approved, Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Briakinumab is combined with Natalizumab.Approved, Investigational
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Briakinumab.Approved, Investigational
RindopepimutThe risk or severity of adverse effects can be increased when Briakinumab is combined with CDX-110.Investigational
RoflumilastRoflumilast may increase the immunosuppressive activities of Briakinumab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Briakinumab.Approved
SRP 299The risk or severity of adverse effects can be increased when Briakinumab is combined with SRP 299.Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Briakinumab.Approved, Investigational
TofacitinibBriakinumab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Briakinumab.Approved, Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Boker A, Kimball AB, Rolz-Cruz G: Biologicals in the treatment of psoriasis. Curr Opin Investig Drugs. 2007 Nov;8(11):939-46. [PubMed:17979028 ]
  2. Sandborn WJ: How future tumor necrosis factor antagonists and other compounds will meet the remaining challenges in Crohn's disease. Rev Gastroenterol Disord. 2004;4 Suppl 3:S25-33. [PubMed:15583528 ]
External Links
ATC CodesL04AC09
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelNot Available
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedBasic ScienceHealthy Volunteers1
1WithdrawnNot AvailableModerate to Severe Plaque Psoriasis1
2TerminatedTreatmentCrohn's Disease (CD)1
3CompletedTreatmentModerate to Severe Plaque Psoriasis2
3CompletedTreatmentPlaque Psoriasis2
3CompletedTreatmentPsoriasis1
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage formsNot Available
PricesNot Available
PatentsNot Available
Properties
StateSolid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Protein heterodimerization activity
Specific Function:
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in periphe...
Gene Name:
IL12B
Uniprot ID:
P29460
Molecular Weight:
37168.645 Da
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes produc...
Gene Name:
IL23A
Uniprot ID:
Q9NPF7
Molecular Weight:
20729.56 Da
Drug created on November 18, 2007 11:25 / Updated on August 17, 2016 12:24