Briakinumab

Identification

Name
Briakinumab
Accession Number
DB05459
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Briakinumab is a human anti-IL-12 monoclonal antibody being developed for the treatment of a number of T-cell driven autoimmune diseases. It targets and neutralize interleukin-12 and interleukin-23, two proteins associated with inflammation, such as pro-inflammatory interleukins or tumor necrosis factor- alpha. Briakinumab represents a novel approach to treating psoriasis, Multiple Sclerosis, Crohn’s Disease and other autoimmune and inflammatory disorders. As of 2011 drug development for psoriasis has been discontinued in the U.S. and Europe.

Protein chemical formula
C6376H9874N1722O1992S44
Protein average weight
146500.0 Da
Sequences
>P42701|I12R1_HUMAN Interleukin-12 receptor beta-1 chain precursor - Homo sapiens
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKA
KM
>Q9NPF7|IL23A_HUMAN Interleukin-23 subunit alpha precursor - Homo sapiens
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
Download FASTA Format
Synonyms
Not Available
External IDs
ABT-874
Categories
UNII
978I8M0P8X
CAS number
339308-60-0

Pharmacology

Indication

Investigated for use/treatment in autoimmune diseases, crohn's disease, multiple sclerosis, psoriasis and psoriatic disorders, and rheumatoid arthritis.

Pharmacodynamics

Briakinumab is a human anti-IL-12 monoclonal antibody being developed for the treatment of a number of T-cell driven autoimmune diseases. It targets and neutralizes interleukin-12 and interleukin-23, two proteins associated with inflammation.

Mechanism of action

Briakinumab targets and neutralizes interleukin-12 and interleukin-23.

TargetActionsOrganism
UInterleukin-12 subunit betaNot AvailableHuman
UInterleukin-23 subunit alphaNot AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding

It targets and neutralize interleukin-12 and interleukin-23, two proteins associated with inflammation in psoriasis and other autoimmune disorders.

Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Briakinumab is combined with Anthrax immune globulin human.Approved
Bacillus calmette-guerin substrain connaught live antigenThe risk or severity of adverse effects can be increased when Briakinumab is combined with Bacillus calmette-guerin substrain connaught live antigen.Approved, Investigational
Bacillus calmette-guerin substrain tice live antigenThe risk or severity of adverse effects can be increased when Briakinumab is combined with Bacillus calmette-guerin substrain tice live antigen.Approved
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Briakinumab.Investigational
Clostridium tetani toxoid antigen (formaldehyde inactivated)The risk or severity of adverse effects can be increased when Briakinumab is combined with Clostridium tetani toxoid antigen (formaldehyde inactivated).Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The risk or severity of adverse effects can be increased when Briakinumab is combined with Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated).Approved
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Briakinumab.Approved
FingolimodBriakinumab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Briakinumab is combined with G17DT.Investigational
GI-5005The risk or severity of adverse effects can be increased when Briakinumab is combined with GI-5005.Investigational
Hepatitis A VaccineThe risk or severity of adverse effects can be increased when Briakinumab is combined with Hepatitis A Vaccine.Approved
Hepatitis B Vaccine (Recombinant)The risk or severity of adverse effects can be increased when Briakinumab is combined with Hepatitis B Vaccine (Recombinant).Approved, Withdrawn
Human rabies virus immune globulinThe risk or severity of adverse effects can be increased when Briakinumab is combined with Human rabies virus immune globulin.Approved
INGN 201The risk or severity of adverse effects can be increased when Briakinumab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Briakinumab is combined with INGN 225.Investigational
Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated)The risk or severity of adverse effects can be increased when Briakinumab is combined with Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated).Approved
LeflunomideThe risk or severity of adverse effects can be increased when Briakinumab is combined with Leflunomide.Approved, Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Briakinumab is combined with Natalizumab.Approved, Investigational
OcrelizumabOcrelizumab may increase the immunosuppressive activities of Briakinumab.Approved, Investigational
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Briakinumab.Approved, Investigational
Rabies virus inactivated antigen, AThe risk or severity of adverse effects can be increased when Briakinumab is combined with Rabies virus inactivated antigen, A.Approved, Investigational
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Briakinumab.Approved, Investigational
RindopepimutThe risk or severity of adverse effects can be increased when Briakinumab is combined with Rindopepimut.Investigational
RoflumilastRoflumilast may increase the immunosuppressive activities of Briakinumab.Approved
Rotavirus VaccineThe risk or severity of adverse effects can be increased when Briakinumab is combined with Rotavirus Vaccine.Approved
Rubella virus vaccineThe risk or severity of adverse effects can be increased when Briakinumab is combined with Rubella virus vaccine.Approved, Investigational
Salmonella typhi ty2 vi polysaccharide antigenThe risk or severity of adverse effects can be increased when Briakinumab is combined with Salmonella typhi ty2 vi polysaccharide antigen.Approved
Salmonella typhi ty21a live antigenThe risk or severity of adverse effects can be increased when Briakinumab is combined with Salmonella typhi ty21a live antigen.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Briakinumab.Approved, Investigational
SRP 299The risk or severity of adverse effects can be increased when Briakinumab is combined with SRP 299.Investigational
TacrolimusTacrolimus may increase the immunosuppressive activities of Briakinumab.Approved, Investigational
TecemotideThe risk or severity of adverse effects can be increased when Briakinumab is combined with Tecemotide.Investigational
TG4010The risk or severity of adverse effects can be increased when Briakinumab is combined with TG4010.Investigational
TofacitinibBriakinumab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Briakinumab.Approved, Investigational
Typhoid VaccineThe risk or severity of adverse effects can be increased when Briakinumab is combined with Typhoid Vaccine.Approved
Varicella Zoster Vaccine (Live/Attenuated)The risk or severity of adverse effects can be increased when Briakinumab is combined with Varicella Zoster Vaccine (Live/Attenuated).Approved
Yellow Fever VaccineThe risk or severity of adverse effects can be increased when Briakinumab is combined with Yellow Fever Vaccine.Approved, Investigational
Food Interactions
Not Available

References

General References
  1. Boker A, Kimball AB, Rolz-Cruz G: Biologicals in the treatment of psoriasis. Curr Opin Investig Drugs. 2007 Nov;8(11):939-46. [PubMed:17979028]
  2. Sandborn WJ: How future tumor necrosis factor antagonists and other compounds will meet the remaining challenges in Crohn's disease. Rev Gastroenterol Disord. 2004;4 Suppl 3:S25-33. [PubMed:15583528]
External Links
PubChem Substance
347910151
Wikipedia
Briakinumab
ATC Codes
L04AC09 — Briakinumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedBasic ScienceHealthy Volunteers1
1WithdrawnNot AvailableModerate to Severe Plaque Psoriasis1
2TerminatedTreatmentCrohn's Disease (CD)1
3CompletedTreatmentModerate to Severe Plaque Psoriasis2
3CompletedTreatmentPsoriasis1
3CompletedTreatmentPsoriasis Vulgaris (Plaque Psoriasis)2

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Protein heterodimerization activity
Specific Function
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC....
Gene Name
IL12B
Uniprot ID
P29460
Uniprot Name
Interleukin-12 subunit beta
Molecular Weight
37168.645 Da
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peri...
Gene Name
IL23A
Uniprot ID
Q9NPF7
Uniprot Name
Interleukin-23 subunit alpha
Molecular Weight
20729.56 Da

Drug created on November 18, 2007 11:25 / Updated on July 02, 2018 18:27