MM-093

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
MM-093
Accession Number
DB05512
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

MM-093 is a recombinant version of human alpha-fetoprotein (hAFP), an immunomodulatory serum protein normally produced at very high levels by the fetus and present in low levels in the blood of adults and children. Research on AFP suggests that it may play a role in modulating the immune system of the mother in order to protect the developing fetus during pregnancy. The presence of hAFP in the pregnant mother’s blood has long been associated with remission of many autoimmune diseases, including rheumatoid arthritis, psoriasis and multiple sclerosis, during the third trimester of pregnancy. Current studies are assessing MM-093’s potential to improve the treatment of autoimmune disease.

Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>>Q4QR90|Q4QR90_RAT Alpha-fetoprotein - Rattus norvegicus (Rat).
MKQPATMKWSASISFLLLLNFAEPRVLHTNEFGIESTLDSSQCPTEKNMFNVATIVVAQF
VQDATKAEVNKMSSDALAAMKENTGDGCLENQLSVFLDEICHETELFNKYGFSGCCNQSG
VERHQCLLARKKTAPDSVPPFHFPETAESCPAYEENRAMSINTFIYDVSKRNPFLYAPTI
LYLAAQYDKAVPACCKADNMEECFQTKRASMAKELREGSMLNEHVCAVIRKFGSRNLQAV
LIIKLSQKFPKANITEIRKLALDVAHIHEQCCHGNAMECLQDGESVMTHICSQQEILSSK
TAECCKLPTIELGYCIIHAENGDKPEGLTLNPSEFLGDRNFAQFSSEEKLLFMASFLHEY
SRNHPNLPVSVILKTAKSYQEILEKCSQSETPSKCQDNMEEELQKHIQESQALAKQSCDL
YQKLGPYYLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASMCCQLSEEKRSACGEGLAD
IYIGHLCLRHEANPVNSGINHCCSSSYSNRRLCITSFLRDETYVPPPFSEDKFIFHKDLC
QAQGRALQTMKQELLINLVKQKPEMTEEQHAAVTADFSGLLEKCCKDQDQEACFAKEGPK
LISKTREALGV
Download FASTA Format
Synonyms
Not Available
Categories
Not Available
UNII
Not Available
CAS number
Not Available

Pharmacology

Indication

Investigated for use/treatment in autoimmune diseases, psoriasis and psoriatic disorders, and rheumatoid arthritis.

Pharmacodynamics

M-093 (Merrimack Pharmaceuticals, Cambridge, Massachusetts, USA) is a non-glycosylated version of human AFP produced by recombinant DNA technology in a transgenic goat expression system.. hAFP is an immunomodulatory serum protein normally produced at very high levels by the fetus and present in low levels in the blood of adults and children. Research on AFP suggests that it may play a role in modulating the immune system of the mother in order to protect the developing fetus during pregnancy. The presence of hAFP in the pregnant mother’s blood has long been associated with remission of many autoimmune diseases, including rheumatoid arthritis, psoriasis and multiple sclerosis, during the third trimester of pregnancy. Current studies are assessing MM-093’s potential to improve the treatment of autoimmune disease.

Mechanism of action

One study states that AFP suppresses autologous lymphocyte proliferation and that improvements in experimental arthritis and autoimmune thyroiditis were associated with significantly reduced numbers of CD4 and CD8 splenocytes, total thymocytes and CD4 thymocytes. This suggests that AFP modulates T cell development and immune responses.

Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
Not Available
Food Interactions
Not Available

References

General References
  1. Dudich E: MM-093, a recombinant human alpha-fetoprotein for the potential treatment of rheumatoid arthritis and other autoimmune diseases. Curr Opin Mol Ther. 2007 Dec;9(6):603-10. [PubMed:18041671]
External Links
PubChem Substance
347910182

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
2CompletedTreatmentPsoriasis1
2CompletedTreatmentRheumatoid Arthritis2
2CompletedTreatmentUveitis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Drug created on November 18, 2007 11:25 / Updated on August 02, 2019 07:46