Farletuzumab

Identification

Name
Farletuzumab
Accession Number
DB05595
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Farletuzumab (MORAb-003) is a fully humanized monoclonal antibody against the folate receptor alpha, for the potential treatment of epithelial ovarian cancer.

Protein structure
Db05595
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>9067_H|farletuzumab|||H-GAMMA-1 (VH(1-119)+CH1(120-217)+HINGE-REGION(218-232)+CH2(233-342)+CH3(343-449))|||||||449||||MW 48946.2|MW 48946.2|
EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYY
ADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCARHGDDPAWFAYWGQGTPVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>9067_L|farletuzumab|||L-KAPPA (V-KAPPA(1-110)+C-KAPPA(111-217))|||||||217||||MW 23755.2|MW 23755.2|
DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVP
SRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS
TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Fareletuzumab
External IDs
MORAb-003
Categories
UNII
2O09BG0OWA
CAS number
896723-44-7

Pharmacology

Indication

Investigated for use/treatment in ovarian cancer.

Pharmacodynamics
Not Available
Mechanism of action
TargetActionsOrganism
AFolate receptor alpha
antibody
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Farletuzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Farletuzumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Farletuzumab.
Anthrax immune globulin humanThe therapeutic efficacy of Anthrax immune globulin human can be decreased when used in combination with Farletuzumab.
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Farletuzumab.
Bacillus calmette-guerin substrain connaught live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain connaught live antigen can be decreased when used in combination with Farletuzumab.
Bacillus calmette-guerin substrain tice live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain tice live antigen can be decreased when used in combination with Farletuzumab.
BasiliximabThe risk or severity of adverse effects can be increased when Basiliximab is combined with Farletuzumab.
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Farletuzumab.
BelimumabThe risk or severity of adverse effects can be increased when Farletuzumab is combined with Belimumab.
Food Interactions
Not Available

References

General References
Not Available
External Links
KEGG Drug
D09343
PubChem Substance
347910184
Wikipedia
Farletuzumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedNot AvailableOvarian Epithelial Cancer1
1CompletedTreatmentOvarian Epithelial Cancer1
1CompletedTreatmentPatients With a Folate-receptor Alpha Expressing Solid Tumor Who Are Not Responsive or Resistant to Standard Therapy and Have no Other Appropriate Treatment1
2CompletedTreatmentAbdominal wall neoplasm / Cancer of the Ovary / Fallopian Tube Cancer1
2CompletedTreatmentAdenocarcinoma of the Lung1
2CompletedTreatmentOvarian Epithelial Cancer1
2RecruitingTreatmentPlatinum-Sensitive Ovarian Cancer in First Relapse1
2TerminatedTreatmentCancer of the Ovary1
2WithdrawnTreatmentResectable, Non-functioning Pituitary Adenoma1
3CompletedTreatmentCancer of the Ovary1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Receptor activity
Specific Function
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analo...
Gene Name
FOLR1
Uniprot ID
P15328
Uniprot Name
Folate receptor alpha
Molecular Weight
29818.94 Da
References
  1. Kalli KR: MORAb-003, a fully humanized monoclonal antibody against the folate receptor alpha, for the potential treatment of epithelial ovarian cancer. Curr Opin Investig Drugs. 2007 Dec;8(12):1067-73. [PubMed:18058577]

Drug created on November 18, 2007 11:26 / Updated on October 01, 2018 14:02