Veltuzumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
Veltuzumab
Accession Number
DB05656
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Veltuzumab is a monoclonal antibody which, as of October 2009, is undergoing Phase I/II clinical trials for the treatment of non-Hodgkin's lymphoma.

Protein structure
Db05656
Protein chemical formula
C6458H9918N1706O2026S46
Protein average weight
Not Available
Sequences
>8932_H|veltuzumab|Humanized||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-234)+CH2(235-344)+CH3(345-451))|||||||451||||MW 49467.6|MW 49467.6|
QVQLQQSGAEVKKPGSSVKVSCKASGYTFTSYNMHWVKQAPGQGLEWIGAIYPGNGDTSY
NQKFKGKATLTADESTNTAYMELSSLRSEDTAFYYCARSTYYGGDWYFDVWGQGTTVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE
EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8932_L|veltuzumab|Humanized||L-KAPPA (V-KAPPA(1-106)+C-KAPPA(107-213))|||||||213||||MW 23205.8|MW 23205.8|
DIQLTQSPSSLSASVGDRVTMTCRASSSVSYIHWFQQKPGKAPKPWIYATSNLASGVPVR
FSGSGSGTDYTFTISSLQPEDIATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
hA20 / IMMU-106
Categories
UNII
BPD4DGQ314
CAS number
728917-18-8

Pharmacology

Indication

Investigated for use/treatment in lymphoma (non-hodgkin's).

Pharmacodynamics
Not Available
Mechanism of action
Not Available
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Veltuzumab.
AbituzumabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Abrilumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Veltuzumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Veltuzumab.
AducanumabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Veltuzumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Veltuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Amatuximab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
Not Available
External Links
Wikipedia
Veltuzumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2Active Not RecruitingTreatmentAggressive NHL / Lymphoma, Large B-Cell, Diffuse (DLBCL) / NHL / Non Hodgkin Lymphoma (NHL)1
1, 2Active Not RecruitingTreatmentAutoimmune Thrombocytopenic Purpura / Purpura, Thrombocytopenic, Autoimmune / Purpura, Thrombocytopenic, Idiopathic1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Follicular Lymphoma (FL) / Leukemia, B-Cell, Chronic / Leukemia, Prolymphocytic / Leukemia, Small Lymphocytic / Lymphoma, B-Cell / Lymphoma, Intermediate-Grade / Lymphoma, Large-Cell / Lymphoma, Low-Grade / Lymphoma, Lymphoplasmacytoid, CLL / Lymphoma, Mixed-Cell / Lymphoma, Small-Cell / Lymphoplasmacytoid Lymphoma, CLL / NHL / Non-Hodgkin's Lymphoma (NHL) / SLL / Small Lymphocytic Lymphoma (SLL)1
1, 2CompletedTreatmentLymphoma, Diffuse / Lymphoma, Diffuse, Mixed Lymphocytic-Histiocytic / Non-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentMalignant Lymphomas1
1, 2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1, 2TerminatedTreatmentFollicular Lymphoma (FL)1
2TerminatedTreatmentRheumatoid Arthritis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Drug created on November 18, 2007 11:26 / Updated on June 04, 2019 06:19